Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantGM-CSF, Mouse

Granulocyte Macrophage Colony Stimulating Factor (GM-CSF) was initially characterized as a growth factor that can support the in vitro colony formation of granulocyte-macrophage progenitors. It is produced by a number of different cell types (including activated T cells, B cells, macrophages, mast cells, endothelial cells and fibroblasts) in response to cytokine or immune and inflammatory stimuli. Besides granulocyte-macrophage progenitors, GM-CSF is also a growth factor for erythroid, megakaryocyte and eosinophil progenitors. On mature hematopoietic cells, GM-CSF is a survival factor for and activates the effectors functions of granulocytes, monocytes/macrophages and eosinophils.

Product Specifications

Product Name Alternative

Granulocyte Macrophage Colony Stimulating Factor, CSF-2, MGI-1GM, GM-CSF, Pluripoietin-alpha, Molgramostin, Sargramostim

Source

CHO

Field of Research

Immunology & Inflammation

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 2 x 10ˆ7 units/mg.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

15~19 kDa, observed by non-reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant murine Granulocyte Macrophage Colony Stimulating Factor (GM-CSF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rmGM-CSF should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASY YQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cwc25 Mouse siRNA Oligo Duplex (Locus ID 67480)
SR410806 1 Kit

Cwc25 Mouse siRNA Oligo Duplex (Locus ID 67480)

Sign In for Pricing
View Details
LMBR1 (NM_022458) Human Untagged Clone
SC322420 10 µg

LMBR1 (NM_022458) Human Untagged Clone

Sign In for Pricing
View Details
Human Keratin-associated protein 10-9, KRTAP10-9 ELISA Kit
MBS9322388-01 48 Well

Human Keratin-associated protein 10-9, KRTAP10-9 ELISA Kit

Sign In for Pricing
View Details
Human Keratin-associated protein 10-9, KRTAP10-9 ELISA Kit
MBS9322388-02 96 Well

Human Keratin-associated protein 10-9, KRTAP10-9 ELISA Kit

Sign In for Pricing
View Details
Human Keratin-associated protein 10-9, KRTAP10-9 ELISA Kit
MBS9322388-03 5x 96 Well

Human Keratin-associated protein 10-9, KRTAP10-9 ELISA Kit

Sign In for Pricing
View Details
Human Keratin-associated protein 10-9, KRTAP10-9 ELISA Kit
MBS9322388-04 10x 96 Well

Human Keratin-associated protein 10-9, KRTAP10-9 ELISA Kit

Sign In for Pricing
View Details