Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantGM-CSF, Mouse

Granulocyte Macrophage Colony Stimulating Factor (GM-CSF) was initially characterized as a growth factor that can support the in vitro colony formation of granulocyte-macrophage progenitors. It is produced by a number of different cell types (including activated T cells, B cells, macrophages, mast cells, endothelial cells and fibroblasts) in response to cytokine or immune and inflammatory stimuli. Besides granulocyte-macrophage progenitors, GM-CSF is also a growth factor for erythroid, megakaryocyte and eosinophil progenitors. On mature hematopoietic cells, GM-CSF is a survival factor for and activates the effectors functions of granulocytes, monocytes/macrophages and eosinophils.

Product Specifications

Product Name Alternative

Granulocyte Macrophage Colony Stimulating Factor, CSF-2, MGI-1GM, GM-CSF, Pluripoietin-alpha, Molgramostin, Sargramostim

Source

CHO

Field of Research

Immunology & Inflammation

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 2 x 10ˆ7 units/mg.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

15~19 kDa, observed by non-reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant murine Granulocyte Macrophage Colony Stimulating Factor (GM-CSF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rmGM-CSF should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASY YQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P2ry13 Rat shRNA Plasmid (Locus ID 310444)
TL700474 1 Kit

P2ry13 Rat shRNA Plasmid (Locus ID 310444)

Sign In for Pricing
View Details
COL5A3 Protein Vector (Human) (pPB-C-His)
PV070373 500 ng

COL5A3 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Anti-ATG5/Apg5 Rabbit Monoclonal Antibody
M00240 100 µL/Vial

Anti-ATG5/Apg5 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Rbm10 Mouse shRNA Plasmid (Locus ID 236732)
TR507163 1 Kit

Rbm10 Mouse shRNA Plasmid (Locus ID 236732)

Sign In for Pricing
View Details
Arg1 Antibody
A57923-50UG 50 µg

Arg1 Antibody

Sign In for Pricing
View Details
CDH15 3'UTR Luciferase Stable Cell Line
TU004027 1.0 mL

CDH15 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details