Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantGM-CSF, Mouse

Granulocyte Macrophage Colony Stimulating Factor (GM-CSF) was initially characterized as a growth factor that can support the in vitro colony formation of granulocyte-macrophage progenitors. It is produced by a number of different cell types (including activated T cells, B cells, macrophages, mast cells, endothelial cells and fibroblasts) in response to cytokine or immune and inflammatory stimuli. Besides granulocyte-macrophage progenitors, GM-CSF is also a growth factor for erythroid, megakaryocyte and eosinophil progenitors. On mature hematopoietic cells, GM-CSF is a survival factor for and activates the effectors functions of granulocytes, monocytes/macrophages and eosinophils.

Product Specifications

Product Name Alternative

Granulocyte Macrophage Colony Stimulating Factor, CSF-2, MGI-1GM, GM-CSF, Pluripoietin-alpha, Molgramostin, Sargramostim

Source

CHO

Field of Research

Immunology & Inflammation

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 2 x 10ˆ7 units/mg.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

15~19 kDa, observed by non-reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant murine Granulocyte Macrophage Colony Stimulating Factor (GM-CSF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rmGM-CSF should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASY YQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDL-1 (Programmed Cell Death 1 Ligand-1, Programmed Death Ligand 1, PD-L1, B7-H1) discontinued. see C2549-22C
P3124-10 100 µg

PDL-1 (Programmed Cell Death 1 Ligand-1, Programmed Death Ligand 1, PD-L1, B7-H1) discontinued. see C2549-22C

Sign In for Pricing
View Details
Anti-ISG15 Rabbit Monoclonal Antibody
M00554-3-200μl 200 µL

Anti-ISG15 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Zingerone
122-48-5 1 Each

Zingerone

Sign In for Pricing
View Details
Acetyl-L-phenylalanine amide
260547-01 2 g

Acetyl-L-phenylalanine amide

Sign In for Pricing
View Details
Acetyl-L-phenylalanine amide
260547-02 5 g

Acetyl-L-phenylalanine amide

Sign In for Pricing
View Details
FABP4 Polyclonal Antibody, Biotin Conjugated
bs-4059R-Biotin 100 µL

FABP4 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details