Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantGM-CSF, Rat

Granulocyte Macrophage-Colony Stimulating Factor (GM-CSF) was initially characterized as a growth factor that can support the in vitro colony formation of granulocyte-macrophage progenitors. Granulocyte Macrophage-Colony Stimulating Factor (GM-CSF) is produced by a number of different cell types, including activated T cells, B cells, macrophages, mast cells, endothelial cells, and fibroblasts, in response to cytokine of immune and inflammatory stimuli. Besides granulocyte-macrophage progenitors, Granulocyte Macrophage-Colony Stimulating Factor (GM-CSF) is a growth factor for erythroid, megakaryocyte, and eosinophil progenitors. On mature hematopoietic, monocytes/macrophages and eosinophils.

Product Specifications

Product Name Alternative

Granulocyte Macrophage Colony Stimulating Factor, CSF-2, MGI-1GM, GM-CSF, Pluripoietin-alpha, Molgramostin, Sargramostim

Source

CHO

Field of Research

Immunology & Inflammation

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 2x10ˆ8 units/mg.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

16-26 kDa, observed by non-reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Rat Granulocyte Macrophage-Colony Stimulating Factor (GM-CSF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rrGM-CSF should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

APTRSPNPVTRPWKHVDAIKEALSLLNDMRALENEKNEDVDIISNEFSIQRPTCVQTRLKLYKQGLRGNLTKLNGALTMI ASHYQTNCPPTPETDCEIEVTTFEDFIKNLKGFLFDIPFDCWKPVQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 Antigen (CD63) Antibody
abx413632 100 µg

CD63 Antigen (CD63) Antibody

Sign In for Pricing
View Details
Olfr934 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
33559064 1.0 µg DNA

Olfr934 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Polink-2 Plus HRP Broad Spectrum DAB Detection Kit
D41-125 125 mL

Polink-2 Plus HRP Broad Spectrum DAB Detection Kit

Sign In for Pricing
View Details
RHCE AAV siRNA Pooled Vector
39502161 1.0 µg

RHCE AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Anti-Proline-rich protein 5 PRR5 Antibody
A05975 0.1 mg

Anti-Proline-rich protein 5 PRR5 Antibody

Sign In for Pricing
View Details
Anti-ATP6V1B2 Mouse Monoclonal Antibody [Clone ID: OTI1E11]
M04927 100 µL

Anti-ATP6V1B2 Mouse Monoclonal Antibody [Clone ID: OTI1E11]

Sign In for Pricing
View Details