Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantGM-CSF, Rat

Granulocyte Macrophage-Colony Stimulating Factor (GM-CSF) was initially characterized as a growth factor that can support the in vitro colony formation of granulocyte-macrophage progenitors. Granulocyte Macrophage-Colony Stimulating Factor (GM-CSF) is produced by a number of different cell types, including activated T cells, B cells, macrophages, mast cells, endothelial cells, and fibroblasts, in response to cytokine of immune and inflammatory stimuli. Besides granulocyte-macrophage progenitors, Granulocyte Macrophage-Colony Stimulating Factor (GM-CSF) is a growth factor for erythroid, megakaryocyte, and eosinophil progenitors. On mature hematopoietic, monocytes/macrophages and eosinophils.

Product Specifications

Product Name Alternative

Granulocyte Macrophage Colony Stimulating Factor, CSF-2, MGI-1GM, GM-CSF, Pluripoietin-alpha, Molgramostin, Sargramostim

Source

CHO

Field of Research

Immunology & Inflammation

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 2x10ˆ8 units/mg.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

16-26 kDa, observed by non-reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Rat Granulocyte Macrophage-Colony Stimulating Factor (GM-CSF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rrGM-CSF should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

APTRSPNPVTRPWKHVDAIKEALSLLNDMRALENEKNEDVDIISNEFSIQRPTCVQTRLKLYKQGLRGNLTKLNGALTMI ASHYQTNCPPTPETDCEIEVTTFEDFIKNLKGFLFDIPFDCWKPVQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

anti-PKNOX1.1
YF-PA13806 100 ug

anti-PKNOX1.1

Sign In for Pricing
View Details
HIF2 Alpha (Hypoxia-Inducible Factor 2 alpha) discontinued
214888-01 100 µg

HIF2 Alpha (Hypoxia-Inducible Factor 2 alpha) discontinued

Sign In for Pricing
View Details
HIF2 Alpha (Hypoxia-Inducible Factor 2 alpha) discontinued
214888-02 200 µg

HIF2 Alpha (Hypoxia-Inducible Factor 2 alpha) discontinued

Sign In for Pricing
View Details
CENPH Antibody
MBS9609375-01 0.1 mL

CENPH Antibody

Sign In for Pricing
View Details
CENPH Antibody
MBS9609375-02 0.2 mL

CENPH Antibody

Sign In for Pricing
View Details
CENPH Antibody
MBS9609375-03 5x 0.2 mL

CENPH Antibody

Sign In for Pricing
View Details