Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantGM-CSF, Rat

Granulocyte Macrophage-Colony Stimulating Factor (GM-CSF) was initially characterized as a growth factor that can support the in vitro colony formation of granulocyte-macrophage progenitors. Granulocyte Macrophage-Colony Stimulating Factor (GM-CSF) is produced by a number of different cell types, including activated T cells, B cells, macrophages, mast cells, endothelial cells, and fibroblasts, in response to cytokine of immune and inflammatory stimuli. Besides granulocyte-macrophage progenitors, Granulocyte Macrophage-Colony Stimulating Factor (GM-CSF) is a growth factor for erythroid, megakaryocyte, and eosinophil progenitors. On mature hematopoietic, monocytes/macrophages and eosinophils.

Product Specifications

Product Name Alternative

Granulocyte Macrophage Colony Stimulating Factor, CSF-2, MGI-1GM, GM-CSF, Pluripoietin-alpha, Molgramostin, Sargramostim

Source

CHO

Field of Research

Immunology & Inflammation

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 2x10ˆ8 units/mg.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

16-26 kDa, observed by non-reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Rat Granulocyte Macrophage-Colony Stimulating Factor (GM-CSF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rrGM-CSF should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

APTRSPNPVTRPWKHVDAIKEALSLLNDMRALENEKNEDVDIISNEFSIQRPTCVQTRLKLYKQGLRGNLTKLNGALTMI ASHYQTNCPPTPETDCEIEVTTFEDFIKNLKGFLFDIPFDCWKPVQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HELLS Protein Vector (Rat) (pPB-C-His)
PV272554 500 ng

HELLS Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
PDGFRL Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2403677 100 µL

PDGFRL Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
CµL5 Rat shRNA Plasmid (Locus ID 64624)
TR710813 1 Kit

CµL5 Rat shRNA Plasmid (Locus ID 64624)

Sign In for Pricing
View Details
MAP2K3 siRNA (Mouse)
MBS8231308-01 15 nmol

MAP2K3 siRNA (Mouse)

Sign In for Pricing
View Details
MAP2K3 siRNA (Mouse)
MBS8231308-02 30 nmol

MAP2K3 siRNA (Mouse)

Sign In for Pricing
View Details
MAP2K3 siRNA (Mouse)
MBS8231308-03 5x 30 nmol

MAP2K3 siRNA (Mouse)

Sign In for Pricing
View Details