Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantGM-CSF, Rat

Granulocyte Macrophage-Colony Stimulating Factor (GM-CSF) was initially characterized as a growth factor that can support the in vitro colony formation of granulocyte-macrophage progenitors. Granulocyte Macrophage-Colony Stimulating Factor (GM-CSF) is produced by a number of different cell types, including activated T cells, B cells, macrophages, mast cells, endothelial cells, and fibroblasts, in response to cytokine of immune and inflammatory stimuli. Besides granulocyte-macrophage progenitors, Granulocyte Macrophage-Colony Stimulating Factor (GM-CSF) is a growth factor for erythroid, megakaryocyte, and eosinophil progenitors. On mature hematopoietic, monocytes/macrophages and eosinophils.

Product Specifications

Product Name Alternative

Granulocyte Macrophage Colony Stimulating Factor, CSF-2, MGI-1GM, GM-CSF, Pluripoietin-alpha, Molgramostin, Sargramostim

Source

CHO

Field of Research

Immunology & Inflammation

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 2x10ˆ8 units/mg.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

16-26 kDa, observed by non-reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Rat Granulocyte Macrophage-Colony Stimulating Factor (GM-CSF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rrGM-CSF should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

APTRSPNPVTRPWKHVDAIKEALSLLNDMRALENEKNEDVDIISNEFSIQRPTCVQTRLKLYKQGLRGNLTKLNGALTMI ASHYQTNCPPTPETDCEIEVTTFEDFIKNLKGFLFDIPFDCWKPVQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRN2 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
27718154 3x 1.0 µg DNA

LRRN2 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Ssxb3 ORF Vector (Mouse) (pORF)
45586014 1.0 µg DNA

Ssxb3 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
EIF2C4-set siRNA/shRNA/RNAi Lentivector (Human)
19092091 4x 500 ng

EIF2C4-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Anti-PDLIM2 Antibody Picoband® Fluoro594 Conjugated
A06506-1-Fluoro594 100 µg/Vial

Anti-PDLIM2 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
CYP21A2 Human shRNA Plasmid Kit (Locus ID 1589)
TR313604 1 Kit

CYP21A2 Human shRNA Plasmid Kit (Locus ID 1589)

Sign In for Pricing
View Details
Cesium fluoride
TRC-C280005-10G 10 g

Cesium fluoride

Sign In for Pricing
View Details