Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantGRO-γ/CXCL3, Human (CHO-expressed)

Chemokine (C-X-C motif) ligand 3 (CXCL3) is a small cytokine belonging to the CXC chemokine family that is also known as GRO3 oncogene (GRO3), GRO protein gamma (GROg) and macrophage inflammatory protein-2-beta (MIP2b) . CXCL3 controls migration and adhesion of monocytes and mediates its effect on its target cell by interacting with cell surface chemokine receptor CXCR2. It has been shown that CXCL3 regulates the migration of precursors of cerebellar granule neurons toward the internal layers of the cerebellum, during morphogenesis.Recombinant humanGRO-gamma/CXCL3 produced in CHO cells is a polypeptide chain containing 73 amino acids. A fully biologically active molecule, rhGRO-gamma/CXCL3 has a molecular mass of 9kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Product Specifications

Product Name Alternative

GRO-gamma; CXCL3

Source

CHO

Field of Research

Immunology & Inflammation

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 98% as analyzed by SDS-PAGE.

Bioactivity

The EC50 value of human GRO-gamma/CXCL3 on Caˆ2+ mobilization assay in CHO-K1/Ga15/hCXCR2 cells (human Ga15 and human CXCR2 stably expressed in CHO-K1 cells) is less than 200 ng/ml.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

9 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human GRO-gamma/CXCL3 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human GRO-gamma/CXCL3 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQ KIIEKILNKGSTN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPS5 (HRP)
569188-01 50 µg

MRPS5 (HRP)

Sign In for Pricing
View Details
MRPS5 (HRP)
569188-02 100 µg

MRPS5 (HRP)

Sign In for Pricing
View Details
Als2Cr12 Polyclonal Antibody
CAC11348-01 50 µg

Als2Cr12 Polyclonal Antibody

Sign In for Pricing
View Details
Als2Cr12 Polyclonal Antibody
CAC11348-02 100 µg

Als2Cr12 Polyclonal Antibody

Sign In for Pricing
View Details
OR8Q1P ORF Vector (Human) (pORF)
ORF027241 1.0 µg DNA

OR8Q1P ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Tnk2 (BC052421) Mouse Tagged ORF Clone
MG211437 10 µg

Tnk2 (BC052421) Mouse Tagged ORF Clone

Sign In for Pricing
View Details