Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantHB-EGF, Human

Proheparin-binding EGF-like growth factor (HB-EGF), also known as DTR, DTS and HEGFL, is a member of the EGF family of mitogens. It is expressed in macrophages, monocytes, endothelial cells and muscle cells. HB-EGF signals through the EGF receptor to stimulate the proliferation of smooth muscle cells, epithelial cells and keratinocytes. Compared to EGF, HB-EGF binds the EGF receptor with higher affinity and is thus more mitogenic, probably due to its ability to bind to heparin and heparin sulfate proteoglycans. HB-EGF has been reported to act as a diphtheria toxin receptor, mediating endocytosis of the bound toxin.

Product Specifications

Product Name Alternative

DTR, DTS, HEGFL

Source

CHO

Field of Research

Cancer Biology

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 0.5 ng/ml, measured in a cell proliferation assay using 3T3 cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

12-14 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human HB-EGF remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human HB-EGF should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

DLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGER CHGLSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR183 siRNA (Human)
CRH1314-01 15 nmol

GPR183 siRNA (Human)

Sign In for Pricing
View Details
GPR183 siRNA (Human)
CRH1314-02 30 nmol

GPR183 siRNA (Human)

Sign In for Pricing
View Details
NUP43 (Nucleoporin Nup43, Nup107-160 Subcomplex Subunit Nup43, p42, FLJ13287, bA350J20.1, p42)
130649 100 µg

NUP43 (Nucleoporin Nup43, Nup107-160 Subcomplex Subunit Nup43, p42, FLJ13287, bA350J20.1, p42)

Sign In for Pricing
View Details
RPL34P24 3'UTR GFP Stable Cell Line
TU071405 1.0 mL

RPL34P24 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
CD24 Rabbit Polyclonal Antibody (APC)
orb2991762 100 µg

CD24 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Lentiviral mouse Ginm1 shRNA (UAS) - Lentiviral mouse Ginm1 shRNA (UAS) (25)
GTR15132665 1 Vial

Lentiviral mouse Ginm1 shRNA (UAS) - Lentiviral mouse Ginm1 shRNA (UAS) (25)

Sign In for Pricing
View Details