Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantHB-EGF, Human

Proheparin-binding EGF-like growth factor (HB-EGF), also known as DTR, DTS and HEGFL, is a member of the EGF family of mitogens. It is expressed in macrophages, monocytes, endothelial cells and muscle cells. HB-EGF signals through the EGF receptor to stimulate the proliferation of smooth muscle cells, epithelial cells and keratinocytes. Compared to EGF, HB-EGF binds the EGF receptor with higher affinity and is thus more mitogenic, probably due to its ability to bind to heparin and heparin sulfate proteoglycans. HB-EGF has been reported to act as a diphtheria toxin receptor, mediating endocytosis of the bound toxin.

Product Specifications

Product Name Alternative

DTR, DTS, HEGFL

Source

CHO

Field of Research

Cancer Biology

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 0.5 ng/ml, measured in a cell proliferation assay using 3T3 cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

12-14 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human HB-EGF remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human HB-EGF should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

DLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGER CHGLSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC-Linked Polyclonal Antibody to Netrin 1 (Ntn1)
MBS2114638-01 0.1 mL

FITC-Linked Polyclonal Antibody to Netrin 1 (Ntn1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Netrin 1 (Ntn1)
MBS2114638-02 0.2 mL

FITC-Linked Polyclonal Antibody to Netrin 1 (Ntn1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Netrin 1 (Ntn1)
MBS2114638-03 0.5 mL

FITC-Linked Polyclonal Antibody to Netrin 1 (Ntn1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Netrin 1 (Ntn1)
MBS2114638-04 1 mL

FITC-Linked Polyclonal Antibody to Netrin 1 (Ntn1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Netrin 1 (Ntn1)
MBS2114638-05 5 mL

FITC-Linked Polyclonal Antibody to Netrin 1 (Ntn1)

Sign In for Pricing
View Details
Phospho-RACGAP1 (Ser387) Rabbit Polyclonal Antibody
orb101402-01 50 μL

Phospho-RACGAP1 (Ser387) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details