Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantHCC‐4/CCL16, Human (CHO-expressed)

Human HCC­4, also named NCC­4and Chemokine (C-C motif) ligand 16 (CCL16) is a small cytokine belonging to the CC chemokine family that is known under several pseudonyms, including Liver-expressed chemokine (LEC) and Monotactin-1 (MTN-1) . It can signal through the CCR8 and CCR1 receptors, and it is chemotactic towards monocytes and lymphocytes but not neutrophils. HCC-4 is expressed weakly by some lymphocytes, including NK cells, T cells, and some T cell clones. The expression of HCC-4 in monocytes is greatly up-regulated in the presence of IL-10. HCC-4 induces a calcium flux in thp-1 cells that are desensitized prior to the expression of RANTES. Recombinant human HCC‐4/CCL16 produced in CHO cells is a single non-glycosylated polypeptide chain containing 97 amino acids. A fully biologically active molecule, rhHCC‐4/CCL16has a molecular mass of 12 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Product Specifications

Product Name Alternative

HCC‐4; CCL16

Source

CHO

Field of Research

Immunology & Inflammation

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 98% as analyzed by SDS-PAGE.

Bioactivity

The EC50 value of human HCC‐4/CCL16 on Caˆ2+ mobilization assay in CHO-K1/Ga15/hCCR1 cells (human Ga15 and human CCR1 stably expressed in CHO-K1 cells) is less than 1.5 μg/ml.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

12 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human HCC‐4°CCL16 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human HCC‐4°CCL16 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLST VKIITAKNGQPQLLNSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cy3-Linked Polyclonal Antibody to Oxidative Stress Induced Growth Inhibitor 1 (OSGIN1)
MBS2077637-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Oxidative Stress Induced Growth Inhibitor 1 (OSGIN1)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Oxidative Stress Induced Growth Inhibitor 1 (OSGIN1)
MBS2077637-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Oxidative Stress Induced Growth Inhibitor 1 (OSGIN1)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Oxidative Stress Induced Growth Inhibitor 1 (OSGIN1)
MBS2077637-03 0.5 mL

Cy3-Linked Polyclonal Antibody to Oxidative Stress Induced Growth Inhibitor 1 (OSGIN1)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Oxidative Stress Induced Growth Inhibitor 1 (OSGIN1)
MBS2077637-04 1 mL

Cy3-Linked Polyclonal Antibody to Oxidative Stress Induced Growth Inhibitor 1 (OSGIN1)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Oxidative Stress Induced Growth Inhibitor 1 (OSGIN1)
MBS2077637-05 5 mL

Cy3-Linked Polyclonal Antibody to Oxidative Stress Induced Growth Inhibitor 1 (OSGIN1)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Oxidative Stress Induced Growth Inhibitor 1 (OSGIN1)
MBS2077637-06 5x 5 mL

Cy3-Linked Polyclonal Antibody to Oxidative Stress Induced Growth Inhibitor 1 (OSGIN1)

Sign In for Pricing
View Details