Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIFN-γRII, Human

IFN-gamma Receptor II, also known as IFNGR2 and IFNGT1, is a transmembrane protein belonging to the type II cytokine receptor family. IFNGR2 is a non-ligand-binding beta chain of the IFN-gamma receptor. It is an integral part of the IFN-gamma signaling transduction pathway and is likely to interact with GAF, JAK1 and JAK2. Defects in IFNGR2 are a cause of autosomal recessive Mendelian susceptibility to mycobacterial disease (MSMD), also known as familial disseminated atypical mycobacterial infection.

Product Specifications

Product Name Alternative

IFNGR2, IFNGT1

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 0.1 μg/ml, measured in a cell cytotoxicity assay using HT-29 (HTB-38) cells in the presence of 1ng/ml human IFN-gamma.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

38-40 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human IFN-gamma Receptor II remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human IFN-gamma Receptor II should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

SQLPAPQHPKIRLYNAEQVLSWEPVALSNSTRPVVYQVQFKYTDSKWFTADIMSIGVNCTQITATECDFTAASPSAGFPM DFNVTLRLRAELGALHSAWVTMPWFQHYRNVTVGPPENIEVTPGEGSLIIRFSSPFDIADTSTAFFCYYVHYWEKGGIQQ VKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHLSNISCYETMADASTELQQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N,N’-Di-Boc-O-di-tert-butyl Pentosidine-d3
TRC-D117833-2.5MG 2.5 mg

N,N’-Di-Boc-O-di-tert-butyl Pentosidine-d3

Sign In for Pricing
View Details
Mapk9 Mouse Gene Knockout Kit (CRISPR)
KN309772RB 1 Kit

Mapk9 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HINT2 (NM_032593) Human Recombinant Protein
TP308371 20 µg

HINT2 (NM_032593) Human Recombinant Protein

Sign In for Pricing
View Details
AO Succinimidyl Ester
#40074 1x 5 mg

AO Succinimidyl Ester

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD31 Antibody[390]
E-AB-F1180G-01 50 Tests

PE/Cyanine5 Anti-Mouse CD31 Antibody[390]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD31 Antibody[390]
E-AB-F1180G-02 100 Tests

PE/Cyanine5 Anti-Mouse CD31 Antibody[390]

Sign In for Pricing
View Details