Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIFN-γ, Human (CHO-expressed)

Human Interferon gamma (hIFN-γ) is amacrophage-activating factor and the lone member of Interferon type II. The active form of IFN-γ is an antiparallel dimer that interacts with the receptor IFN-γR1 and sets off IFN-γ/JAK/STAT pathway. IFN-γ signaling does diverse biological functions primarily related to host defense and immune regulation, including antiviral and antibacterial defense, apoptosis, inflammation, and innate and acquired immunity. While IFN-γ–induced inflammatory cascade summons a variety of immune-related cell types, such as macrophages, natural killer (NK) cells and cytotoxic T lymphocytes (CTLs), IFN-γ is also implicated in resistance to NK cell and CTL responses and in immune escape in a variety of cancers.

Product Specifications

Product Name Alternative

Immune Interferon, type II interferon, T cell interferon, MAF, IFNG, IFG, IFI, IFN-gamma, IFNγ

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 5x10ˆ5 units/mg.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

15-25 kDa, observed by non-reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Interferon gamma (IFN-γ) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rh IFN-γ should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVK FFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Lung
CS706398 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Sema3e Mouse Gene Knockout Kit (CRISPR)
KN515497 1 Kit

Sema3e Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Scyl3 Mouse Gene Knockout Kit (CRISPR)
KN515416 1 Kit

Scyl3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Pyridinium Dichromate
TRC-P991580-1G 1 g

Pyridinium Dichromate

Sign In for Pricing
View Details
Pdcd1 Hamster Monoclonal Antibody [Clone ID: J43]
AM31881PU-N 250 µg

Pdcd1 Hamster Monoclonal Antibody [Clone ID: J43]

Sign In for Pricing
View Details
FABP3 Rabbit Monoclonal Antibody
TA423187 100 µL

FABP3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details