Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIFN-γ, Rat (CHO-expressed)

Interferon-γ (IFN-γ), also known as Type II interferon or immune interferon, is a cytokine produced primarily by T-lymphocytes and natural killer cells. The active form of IFN-γ is an antiparallel dimer that interacts with the receptor IFN-γR1 and sets off IFN-γ/JAK/STAT pathway. IFN-γ signaling does diverse biological functions primarily related to host defense and immune regulation, including antiviral and antibacterial defense, apoptosis, inflammation, and innate and acquired immunity. While IFN-γ–induced inflammatory cascade summons a variety of immune-related cell types, such as macrophages, natural killer (NK) cells and cytotoxic T lymphocytes (CTLs), IFN-γ is also implicated in resistance to NK cell and CTL responses and in immune escape in a variety of cancers.

Product Specifications

Product Name Alternative

Immune Interferon, type II interferon, T cell interferon, MAF, IFNG, IFG, IFI, IFN-gamma, IFNγ

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 4x10ˆ5 units/mg.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

15-25 kDa, observed by non-reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Rat Interferon gamma (IFN-γ) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rrIFN-γ should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITN FFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mix-n-StainTM FITC Antibody Labeling Kit, 1x (50-100ug) labeling
#92296 1 Kit

Mix-n-StainTM FITC Antibody Labeling Kit, 1x (50-100ug) labeling

Sign In for Pricing
View Details
Nkx3.1 (NKX3-1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7F6]
TA805166AM 100 µL

Nkx3.1 (NKX3-1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7F6]

Sign In for Pricing
View Details
Sdad1 Mouse Gene Knockout Kit (CRISPR)
KN515417 1 Kit

Sdad1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-NP-AMOZ
TRC-N894950-10MG 10 mg

2-NP-AMOZ

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Anti-Human CD8a Antibody[OKT-8]
E-AB-F1110T-01 20 Tests

Elab Fluor® Violet 610 Anti-Human CD8a Antibody[OKT-8]

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Anti-Human CD8a Antibody[OKT-8]
E-AB-F1110T-02 100 Tests

Elab Fluor® Violet 610 Anti-Human CD8a Antibody[OKT-8]

Sign In for Pricing
View Details