Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-10, Mouse (CHO-expressed)

Interleukin-10 (IL-10), initially known as Cytokine Synthesis Inhibitory Factor (CSIF), belongs to the IL-10 family and shares more than 80% sequence homology with the Epstein-Barr Virus protein BCRFI. It is produced by many immune cells, such as T-cells, macrophages, mast cells and dendritic cells. It is usually secreted as a homodimer and, upon binding to its receptor, inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF, by activated macrophages and Th2 cells. It also displays the ability to suppress Antigen-Presenting Cell (APC) function. The net effect of Interleukin-10 appears to be inhibitory; however, stimulatory effects, such as stimulation of B cell maturation and antibody production, are also reported.

Product Specifications

Product Name Alternative

Interleukin-10, IL10

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 0.2 ng/ml, measured in a cell proliferation assay using MC/9 cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

21-23 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant murine Interleukin-10 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, murine Interleukin-10 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQA EKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-UQCRB Antibody
MBS8291833-01 0.03 mL

Anti-UQCRB Antibody

Sign In for Pricing
View Details
Anti-UQCRB Antibody
MBS8291833-02 0.05 mL

Anti-UQCRB Antibody

Sign In for Pricing
View Details
Anti-UQCRB Antibody
MBS8291833-03 0.1 mL

Anti-UQCRB Antibody

Sign In for Pricing
View Details
Anti-UQCRB Antibody
MBS8291833-04 0.2 mL

Anti-UQCRB Antibody

Sign In for Pricing
View Details
Anti-UQCRB Antibody
MBS8291833-05 5x 0.2 mL

Anti-UQCRB Antibody

Sign In for Pricing
View Details
Human IL28 Receptor alpha (IFNLR1) (NM_173064) AAV Particle
RC221831A1V 250 µL

Human IL28 Receptor alpha (IFNLR1) (NM_173064) AAV Particle

Sign In for Pricing
View Details