Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-10, Mouse (CHO-expressed)

Interleukin-10 (IL-10), initially known as Cytokine Synthesis Inhibitory Factor (CSIF), belongs to the IL-10 family and shares more than 80% sequence homology with the Epstein-Barr Virus protein BCRFI. It is produced by many immune cells, such as T-cells, macrophages, mast cells and dendritic cells. It is usually secreted as a homodimer and, upon binding to its receptor, inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF, by activated macrophages and Th2 cells. It also displays the ability to suppress Antigen-Presenting Cell (APC) function. The net effect of Interleukin-10 appears to be inhibitory; however, stimulatory effects, such as stimulation of B cell maturation and antibody production, are also reported.

Product Specifications

Product Name Alternative

Interleukin-10, IL10

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 0.2 ng/ml, measured in a cell proliferation assay using MC/9 cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

21-23 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant murine Interleukin-10 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, murine Interleukin-10 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQA EKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CYP1A1/ Cytochrome P450 1A1 ELISA Kit
RK04431 96 Tests

Human CYP1A1/ Cytochrome P450 1A1 ELISA Kit

Sign In for Pricing
View Details
HBcAg [Hepatitis B virus] (18-27)
MBS5764194 Inquire

HBcAg [Hepatitis B virus] (18-27)

Sign In for Pricing
View Details
Recombinant Human TCN2 protein
NBP0566 1 mg

Recombinant Human TCN2 protein

Sign In for Pricing
View Details
Human ARRDC4 qPCR Primer Pair
QH58389S 200 Tests

Human ARRDC4 qPCR Primer Pair

Sign In for Pricing
View Details
Canine Integrin Alpha X (ITGAX) ELISA Kit
MBS9940463-01 48 Well

Canine Integrin Alpha X (ITGAX) ELISA Kit

Sign In for Pricing
View Details
Canine Integrin Alpha X (ITGAX) ELISA Kit
MBS9940463-02 96 Well

Canine Integrin Alpha X (ITGAX) ELISA Kit

Sign In for Pricing
View Details