Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-10, Mouse (CHO-expressed)

Interleukin-10 (IL-10), initially known as Cytokine Synthesis Inhibitory Factor (CSIF), belongs to the IL-10 family and shares more than 80% sequence homology with the Epstein-Barr Virus protein BCRFI. It is produced by many immune cells, such as T-cells, macrophages, mast cells and dendritic cells. It is usually secreted as a homodimer and, upon binding to its receptor, inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF, by activated macrophages and Th2 cells. It also displays the ability to suppress Antigen-Presenting Cell (APC) function. The net effect of Interleukin-10 appears to be inhibitory; however, stimulatory effects, such as stimulation of B cell maturation and antibody production, are also reported.

Product Specifications

Product Name Alternative

Interleukin-10, IL10

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 0.2 ng/ml, measured in a cell proliferation assay using MC/9 cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

21-23 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant murine Interleukin-10 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, murine Interleukin-10 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQA EKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ddi2 (NM_001017966) Mouse Tagged ORF Clone
MG216017 10 µg

Ddi2 (NM_001017966) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CERD4 Rabbit pAb
E47R13866 100 µL

CERD4 Rabbit pAb

Sign In for Pricing
View Details
FHL1 discontinued
389156 200 µL

FHL1 discontinued

Sign In for Pricing
View Details
Borosilicate glass funnel 60 angle 140 mL
DD68961 10 / PCK

Borosilicate glass funnel 60 angle 140 mL

Sign In for Pricing
View Details
TTC9C CRISPR Activation Plasmid (m2)
sc-427692-ACT-2 20 µg

TTC9C CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
3,4-Difluoro-DL-phenylalanine
PC2874K-01 250 mg

3,4-Difluoro-DL-phenylalanine

Sign In for Pricing
View Details