Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-12, Mouse

Interleukin-12 (IL-12), also known as NKSF, TCMF, CLMF and TSF, is a heterodimeric cytokine composed of p35 and p40 subunits. It is produced by monocytes, macrophages, B cells and dendritic cells in response to bacterial lipopolysaccharides and intracellular pathogens. IL-12 signals throughtheIL-12 receptor complex, which is comprised of IL-12 Rβ1 and IL-12 Rβ2. IL-12 induces the proliferation and activation of hematopoietic stem cells, natural killer cells and T- cells. It is indispensible during the development of Th1 cells, leading to the production of IFN-gamma and IL-2.

Product Specifications

Product Name Alternative

Interleukin-12, IL12

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 0.15 ng/ml, measured in a cell proliferation assay using 2D6 cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

27-29 kDa (p35) and 45-50 kDa (p40), observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant murineInterleukin-12 (IL-12), remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, murine Interleukin-12 (IL-12), His should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

P35: RVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTT RGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEA DPYRVKMKLCILLHAFSTRVVTINRVMGYLSSA p40: MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEF LDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWL VQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEE TLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTP HSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSS CSKWACVPCRVRS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Monoclonal ICOS Antibody (feladilimab) [CoraFluor 1]
NBP3-28241CL1 0.1 mL

Human Monoclonal ICOS Antibody (feladilimab) [CoraFluor 1]

Sign In for Pricing
View Details
AMDHD2 (NM_001145815) Human Untagged Clone
SC326598 10 µg

AMDHD2 (NM_001145815) Human Untagged Clone

Sign In for Pricing
View Details
PLEKHM1 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-8062R-APC-Cy5.5 100 µL

PLEKHM1 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Lentiviral human SMCO4 sgRNA gene knockout kit - Lentiviral human SMCO4 sgRNA gene knockout kit (plasmid)
GTR15369701 1 Vial

Lentiviral human SMCO4 sgRNA gene knockout kit - Lentiviral human SMCO4 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Bcar3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6484707 1.0 µg DNA

Bcar3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Bglap2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4346908 1.0 µg DNA

Bglap2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details