Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-13, His, Mouse (CHO-expressed)

Interleukin-13 (IL-13), also known as T-cell activation protein P600, is an immunoregulatory cytokine belonging to the IL-4/IL-13 family. It is produced by activated Th2 cells, mast cells and NK cells. IL-13 signals through a receptor complex composed of IL-4Rα and IL13Rα1 (or IL13Rα2) . IL-13 inhibits the expression of inflammatory cytokines such as IL-1β, TNF-α and IL-6 by monocytes and macrophages. It also induces B cell activation and IgE secretion.

Product Specifications

Product Name Alternative

Interleukin-13, IL13

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 20 ng /ml, measured in a cell proliferation assay using R&D TF-1 cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

14-30 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant murine Interleukin-13 (IL-13), His remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, murine Interleukin-13 (IL-13), His should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

PVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTV SSLPDTKIEVAHFITKLLSYTKQLFRHGPFHHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human CAP1 shRNA (UAS) - Lentiviral human CAP1 shRNA (UAS, iRFP) (25)
GTR15093062 1 Vial

Lentiviral human CAP1 shRNA (UAS) - Lentiviral human CAP1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Eimeria gallopavonis RT PCR kit
RTq-V399-50D 50T

Eimeria gallopavonis RT PCR kit

Sign In for Pricing
View Details
Exosome Component 9 (EXOSC9) (NM_001034194) Human Recombinant Protein
TP323537 20 µg

Exosome Component 9 (EXOSC9) (NM_001034194) Human Recombinant Protein

Sign In for Pricing
View Details
OSTF1 (Osteoclast Stimulating Factor 1, FLJ20559, OSF, SH3P2, bA235O14.1)
249651 50 µL

OSTF1 (Osteoclast Stimulating Factor 1, FLJ20559, OSF, SH3P2, bA235O14.1)

Sign In for Pricing
View Details
IL1RAPL1 Antibody - C-terminal region : FITC (ARP73886_P050-FITC)
ARP73886_P050-FITC 100 µL

IL1RAPL1 Antibody - C-terminal region : FITC (ARP73886_P050-FITC)

Sign In for Pricing
View Details
Rat coagulation factor ⅩⅢ,FⅩⅢ ELISA Kit
CN-01416R2 48T

Rat coagulation factor ⅩⅢ,FⅩⅢ ELISA Kit

Sign In for Pricing
View Details