Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-13, His, Mouse (CHO-expressed)

Interleukin-13 (IL-13), also known as T-cell activation protein P600, is an immunoregulatory cytokine belonging to the IL-4/IL-13 family. It is produced by activated Th2 cells, mast cells and NK cells. IL-13 signals through a receptor complex composed of IL-4Rα and IL13Rα1 (or IL13Rα2) . IL-13 inhibits the expression of inflammatory cytokines such as IL-1β, TNF-α and IL-6 by monocytes and macrophages. It also induces B cell activation and IgE secretion.

Product Specifications

Product Name Alternative

Interleukin-13, IL13

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 20 ng /ml, measured in a cell proliferation assay using R&D TF-1 cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

14-30 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant murine Interleukin-13 (IL-13), His remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, murine Interleukin-13 (IL-13), His should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

PVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTV SSLPDTKIEVAHFITKLLSYTKQLFRHGPFHHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,3-Diaminopyridine
sc-254309 1 g

2,3-Diaminopyridine

Sign In for Pricing
View Details
EPAS1, NT (EPAS1, BHLHE73, HIF2A, MOP2, PASD2, Endothelial PAS domain-containing protein 1, Basic-helix-loop-helix-PAS protein MOP2, Class E basic helix-loop-helix protein 73, HIF-1-alpha-like factor, Hypoxia-inducible factor 2-alpha, Member of PAS protein 2, PAS domain-containing protein 2) (PE) discontinued
035103-PE 200 µL

EPAS1, NT (EPAS1, BHLHE73, HIF2A, MOP2, PASD2, Endothelial PAS domain-containing protein 1, Basic-helix-loop-helix-PAS protein MOP2, Class E basic helix-loop-helix protein 73, HIF-1-alpha-like factor, Hypoxia-inducible factor 2-alpha, Member of PAS protein 2, PAS domain-containing protein 2) (PE) discontinued

Sign In for Pricing
View Details
Fas Rabbit mAb
MBS8602738-01 0.1 mL

Fas Rabbit mAb

Sign In for Pricing
View Details
Fas Rabbit mAb
MBS8602738-02 0.1 mL (AF405L)

Fas Rabbit mAb

Sign In for Pricing
View Details
Fas Rabbit mAb
MBS8602738-03 0.1 mL (AF405S)

Fas Rabbit mAb

Sign In for Pricing
View Details
Fas Rabbit mAb
MBS8602738-04 0.1 mL (AF610)

Fas Rabbit mAb

Sign In for Pricing
View Details