Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-18BP, Human

Interleukin-18 binding protein, also known as IL-18BP and tadekinig-alfa, is a secreted glycoprotein that contains an Ig-like C2-type domain. It is expressed in heart, lung, placenta and spleen. IL-18BP functions as an inhibitor of the proinflammatory cytokine IL-18. It binds to IL-18, prevents the binding of IL-18 to its receptor, and thus blocks IL-18-induced IFN-gamma production. The complete Ig domain has been shown to mediate the binding and neutralizing properties. IFN-gamma is able to upregulate the expression of IL-18BP, indicating that IL-18 activity is regulated by a feedback mechanism through IL-18BP.

Product Specifications

Product Name Alternative

Interleukin-18 Binding Protein; IL18 BP

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 30 ng /ml, measured in a bioassay using KG-1 cells in the presence of 50ng/ml Human IL-18.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

42-44 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human IL-18BP remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human IL-18BP should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

TPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHL PGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSP QQQG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRB1 Rabbit Polyclonal Antibody (BF350)
orb2518608 100 µL

CRB1 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
LIN28A Antibody (Center)
MBS9201994-01 0.08 mL

LIN28A Antibody (Center)

Sign In for Pricing
View Details
LIN28A Antibody (Center)
MBS9201994-02 0.4 mL

LIN28A Antibody (Center)

Sign In for Pricing
View Details
LIN28A Antibody (Center)
MBS9201994-03 5x 0.4 mL

LIN28A Antibody (Center)

Sign In for Pricing
View Details
Butein
FB19374-01 100 mg

Butein

Sign In for Pricing
View Details
Butein
FB19374-02 250 mg

Butein

Sign In for Pricing
View Details