Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-1α, Rat

Interleukin-1 alpha (IL-1α), is produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1alpha and IL-1beta bind to the same receptor and have similar if not identical biological properties. These cytokines have a broad range of activities including stimulation of thymocyte proliferation via IL-2 release, B-cell maturation and proliferation, mitogenic FGF-like activity, and the ability to stimulate the release of prostaglandin and collagenase from synovial cells. However, whereas IL-1beta is a secreted cytokine, IL-1alpha is predominantly a cell-associated cytokine.

Product Specifications

Product Name Alternative

Interleukin-1α, IL1α; Hematopoietin-1, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF)

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 5 pg/ml, measured in a proliferation assay using D10S cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

17~22 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Rat Interleukin-1 alpha remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat Interleukin-1 alpha should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

APHSFQNNLRYKLIRIVKQEFIMNDSLNQNIYVDMDRIHLKAASLNDLQLEVKFDMYAYSSGGDDSKYPVTLKVSNTQLF VSAQGEDKPVLLKEIPETPKLITGSETDLIFFWEKINSKNYFTSAAFPELLIATKEQSQVHLARGLPSMIDFQIS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CELLSTORE Movella Portable Cryogenic Transfer Unit
CS-TRS-4-01 1 Unit

CELLSTORE Movella Portable Cryogenic Transfer Unit

Sign In for Pricing
View Details
CELLSTORE Movella Portable Cryogenic Transfer Unit
CS-TRS-4-02 1 Unit

CELLSTORE Movella Portable Cryogenic Transfer Unit

Sign In for Pricing
View Details
EIF4E2 (Eukaryotic Translation Initiation Factor 4E Type 2, eIF4E Type 2, eIF-4E Type 2, mRNA Cap-binding Protein Type 3, Eukaryotic Translation Initiation Factor 4E-like 3, Eukaryotic Translation Initiation Factor 4E Homologous Protein, mRNA Cap-binding
MBS6475338-01 0.1 mL

EIF4E2 (Eukaryotic Translation Initiation Factor 4E Type 2, eIF4E Type 2, eIF-4E Type 2, mRNA Cap-binding Protein Type 3, Eukaryotic Translation Initiation Factor 4E-like 3, Eukaryotic Translation Initiation Factor 4E Homologous Protein, mRNA Cap-binding

Sign In for Pricing
View Details
EIF4E2 (Eukaryotic Translation Initiation Factor 4E Type 2, eIF4E Type 2, eIF-4E Type 2, mRNA Cap-binding Protein Type 3, Eukaryotic Translation Initiation Factor 4E-like 3, Eukaryotic Translation Initiation Factor 4E Homologous Protein, mRNA Cap-binding
MBS6475338-02 5x 0.1 mL

EIF4E2 (Eukaryotic Translation Initiation Factor 4E Type 2, eIF4E Type 2, eIF-4E Type 2, mRNA Cap-binding Protein Type 3, Eukaryotic Translation Initiation Factor 4E-like 3, Eukaryotic Translation Initiation Factor 4E Homologous Protein, mRNA Cap-binding

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Receptor Activator Of Nuclear Factor Kappa B (RANk)
MBS2062608-01 0.1 mL

HRP-Linked Polyclonal Antibody to Receptor Activator Of Nuclear Factor Kappa B (RANk)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Receptor Activator Of Nuclear Factor Kappa B (RANk)
MBS2062608-02 0.2 mL

HRP-Linked Polyclonal Antibody to Receptor Activator Of Nuclear Factor Kappa B (RANk)

Sign In for Pricing
View Details