Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-1α, Rat

Interleukin-1 alpha (IL-1α), is produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1alpha and IL-1beta bind to the same receptor and have similar if not identical biological properties. These cytokines have a broad range of activities including stimulation of thymocyte proliferation via IL-2 release, B-cell maturation and proliferation, mitogenic FGF-like activity, and the ability to stimulate the release of prostaglandin and collagenase from synovial cells. However, whereas IL-1beta is a secreted cytokine, IL-1alpha is predominantly a cell-associated cytokine.

Product Specifications

Product Name Alternative

Interleukin-1α, IL1α; Hematopoietin-1, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF)

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 5 pg/ml, measured in a proliferation assay using D10S cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

17~22 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Rat Interleukin-1 alpha remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat Interleukin-1 alpha should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

APHSFQNNLRYKLIRIVKQEFIMNDSLNQNIYVDMDRIHLKAASLNDLQLEVKFDMYAYSSGGDDSKYPVTLKVSNTQLF VSAQGEDKPVLLKEIPETPKLITGSETDLIFFWEKINSKNYFTSAAFPELLIATKEQSQVHLARGLPSMIDFQIS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Benchtop High Temperature Drying Oven
LX103DOA 1 Unit

Benchtop High Temperature Drying Oven

Sign In for Pricing
View Details
Lentiviral human HOXC4 shRNA (UAS) - Lentiviral human HOXC4 shRNA (UAS, RFP) (25)
GTR15145139 1 Vial

Lentiviral human HOXC4 shRNA (UAS) - Lentiviral human HOXC4 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Human Creatine Kinase (CK) ELISA Kit
YP-W16154-01 48 Tests

Human Creatine Kinase (CK) ELISA Kit

Sign In for Pricing
View Details
Human Creatine Kinase (CK) ELISA Kit
YP-W16154-02 96 Tests

Human Creatine Kinase (CK) ELISA Kit

Sign In for Pricing
View Details
4- (4-Hydroxymethyl-3-methoxyphenoxy) butyryl BHA resin
232569-01 1 g

4- (4-Hydroxymethyl-3-methoxyphenoxy) butyryl BHA resin

Sign In for Pricing
View Details
4- (4-Hydroxymethyl-3-methoxyphenoxy) butyryl BHA resin
232569-02 5 g

4- (4-Hydroxymethyl-3-methoxyphenoxy) butyryl BHA resin

Sign In for Pricing
View Details