Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-1β, Human (CHO-expressed)

Interleukin 1 beta is a proinflammatory cytokine produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1 alpha and IL-1 beta binds to the same receptor and has similar if not identical biological properties. These cytokines have a broad range of activities including, stimulation of thymocyte proliferation, by inducing IL-2 release, B-cell maturation and proliferation, mitogenic FGF-like activity and the ability to stimulate the release of prostaglandin and collagenase from synovial cells. However, whereas IL-1 beta is a secreted cytokine, IL-1 alpha is predominantly a cell-associated cytokine.

Product Specifications

Product Name Alternative

Interleukin-1β; IL-1β; Catabolin, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL1F2, IL-1 beta.

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED501 x 10ˆ8 units/mg.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

17kDa, observed by non-reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human Interleukin 1 beta (IL-1 beta) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhIL-1β should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTL QLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX10 (Melanoma Marker) (SOX10/2311R), CF740 conjugate, 0.1mg/mL
BNC742311-100 1x 100 µL

SOX10 (Melanoma Marker) (SOX10/2311R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Uncoated Porcine IL-4 (Interleukin 4) ELISA Kit
E-UNEL-P0009-01 5x 96 Tests

Uncoated Porcine IL-4 (Interleukin 4) ELISA Kit

Sign In for Pricing
View Details
Uncoated Porcine IL-4 (Interleukin 4) ELISA Kit
E-UNEL-P0009-02 15x 96 Tests

Uncoated Porcine IL-4 (Interleukin 4) ELISA Kit

Sign In for Pricing
View Details
CD8A (Cytotoxic-&Suppressor T-Cell Marker) (rC8/468), 0.2mg/mL
BNUB1867-100 1x 100 µL

CD8A (Cytotoxic-&Suppressor T-Cell Marker) (rC8/468), 0.2mg/mL

Sign In for Pricing
View Details
Human KIF5B, N-Twin Strep, C-His Tag
HA210680-01 20 µg

Human KIF5B, N-Twin Strep, C-His Tag

Sign In for Pricing
View Details
Human KIF5B, N-Twin Strep, C-His Tag
HA210680-02 50 µg

Human KIF5B, N-Twin Strep, C-His Tag

Sign In for Pricing
View Details