Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-1β, Human (CHO-expressed)

Interleukin 1 beta is a proinflammatory cytokine produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1 alpha and IL-1 beta binds to the same receptor and has similar if not identical biological properties. These cytokines have a broad range of activities including, stimulation of thymocyte proliferation, by inducing IL-2 release, B-cell maturation and proliferation, mitogenic FGF-like activity and the ability to stimulate the release of prostaglandin and collagenase from synovial cells. However, whereas IL-1 beta is a secreted cytokine, IL-1 alpha is predominantly a cell-associated cytokine.

Product Specifications

Product Name Alternative

Interleukin-1β; IL-1β; Catabolin, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL1F2, IL-1 beta.

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED501 x 10ˆ8 units/mg.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

17kDa, observed by non-reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human Interleukin 1 beta (IL-1 beta) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhIL-1β should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTL QLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RRAD Recombinant Rabbit mAb
BS48558-01 50 µL

RRAD Recombinant Rabbit mAb

Sign In for Pricing
View Details
RRAD Recombinant Rabbit mAb
BS48558-02 100 µL

RRAD Recombinant Rabbit mAb

Sign In for Pricing
View Details
SYT13 3'UTR Luciferase Stable Cell Line
TU025033 1.0 mL

SYT13 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Human Follistatin
MBS7609555-01 0.05 mg

Recombinant Human Follistatin

Sign In for Pricing
View Details
Recombinant Human Follistatin
MBS7609555-02 0.2 mg

Recombinant Human Follistatin

Sign In for Pricing
View Details
Recombinant Human Follistatin
MBS7609555-03 1 mg

Recombinant Human Follistatin

Sign In for Pricing
View Details