Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-1β, Mouse (CHO-expressed)

Interleukin-1 (IL-1) is a family of cytokines that play a central role in the regulation of immune and inflammatory responses to infections or sterile insults. IL-1α and IL-1β are the first two members discovered in this family, which are the products of distinct genes recognizing the same cell surface receptors. IL-1α and IL-1β are structurally related polypeptides that show approximately 25% homology at the amino acid level. Both proteins are produced by a wide variety of cells in response to stimuli such as those produced by inflammatory agents, infections, or microbial endotoxins. The proteins are synthesized as 31 kDa precursors that are subsequently cleaved into proteins with molecular weights of approximately 17.5 kDa. The specific protease responsible for the processing of IL-1β is interleukin 1β-converting enzyme (ICE) /caspase-1. Mature human and mouse IL-1β share approximately 75% amino acid sequence identity where human IL-1β has been found to be active on murine cell lines. GenScript Interleukin (IL) -1β, murine, produced in CHO cells, is a non-glycosylated polypeptide chain containing 152 amino acids and having a molecular mass of 17,400 Da.

Product Specifications

Product Name Alternative

Interleukin-1β; IL-1β; Catabolin, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL1F2, IL-1 beta.

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 1x10ˆ8 units/mg.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

17.4 kDa, observed by non-reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Murine Interleukin 1 beta (IL-1 beta) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rmIL-1beta should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTL QLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Aminophenol-4-sulfonamide
OR95408-01 500 g

2-Aminophenol-4-sulfonamide

Sign In for Pricing
View Details
2-Aminophenol-4-sulfonamide
OR95408-02 2.5 Kg

2-Aminophenol-4-sulfonamide

Sign In for Pricing
View Details
2-Aminophenol-4-sulfonamide
OR95408-03 10 Kg

2-Aminophenol-4-sulfonamide

Sign In for Pricing
View Details
25.0 mL TipOne positive displacement tip for repeating pipettes, non-sterile, bulk, 100 tips
4751-2500 100 Tips

25.0 mL TipOne positive displacement tip for repeating pipettes, non-sterile, bulk, 100 tips

Sign In for Pricing
View Details
Anti-PRAM1 Antibody Picoband®, APC Conjugate
A10037-2-APC 100 µg/Vial

Anti-PRAM1 Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details
ALDH18A1 Antibody
orb1261001 100 µL

ALDH18A1 Antibody

Sign In for Pricing
View Details