Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-1β, Mouse (CHO-expressed)

Interleukin-1 (IL-1) is a family of cytokines that play a central role in the regulation of immune and inflammatory responses to infections or sterile insults. IL-1α and IL-1β are the first two members discovered in this family, which are the products of distinct genes recognizing the same cell surface receptors. IL-1α and IL-1β are structurally related polypeptides that show approximately 25% homology at the amino acid level. Both proteins are produced by a wide variety of cells in response to stimuli such as those produced by inflammatory agents, infections, or microbial endotoxins. The proteins are synthesized as 31 kDa precursors that are subsequently cleaved into proteins with molecular weights of approximately 17.5 kDa. The specific protease responsible for the processing of IL-1β is interleukin 1β-converting enzyme (ICE) /caspase-1. Mature human and mouse IL-1β share approximately 75% amino acid sequence identity where human IL-1β has been found to be active on murine cell lines. GenScript Interleukin (IL) -1β, murine, produced in CHO cells, is a non-glycosylated polypeptide chain containing 152 amino acids and having a molecular mass of 17,400 Da.

Product Specifications

Product Name Alternative

Interleukin-1β; IL-1β; Catabolin, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL1F2, IL-1 beta.

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 1x10ˆ8 units/mg.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

17.4 kDa, observed by non-reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Murine Interleukin 1 beta (IL-1 beta) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rmIL-1beta should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTL QLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCAMP2 Human siRNA Oligo Duplex (Locus ID 10066)
SR322982 1 Kit

SCAMP2 Human siRNA Oligo Duplex (Locus ID 10066)

Sign In for Pricing
View Details
Glasgow's MEM GMEM (BHK21) with L-glutamine and TPB. W/O Sodium Bicarbonate.
GMP05-10LT 10 L

Glasgow's MEM GMEM (BHK21) with L-glutamine and TPB. W/O Sodium Bicarbonate.

Sign In for Pricing
View Details
Human Procollagen I C-Terminal Propeptide (PICP) ELISA Kit
EKL59886 96 Tests

Human Procollagen I C-Terminal Propeptide (PICP) ELISA Kit

Sign In for Pricing
View Details
ANAPC2 Over-expression Lysate Product
GWB-B055D5 0.1 mg

ANAPC2 Over-expression Lysate Product

Sign In for Pricing
View Details
RNF139 AAV Vector (Human) (CMV)
40251101 1 µg

RNF139 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Rpusd1 Mouse shRNA Plasmid (Locus ID 106707)
TL505755 1 Kit

Rpusd1 Mouse shRNA Plasmid (Locus ID 106707)

Sign In for Pricing
View Details