Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-3, His, Rat

Interleukin-3 (IL-3), also known as MCGF, Multi-CSF, HCGF and P-cell stimulation factor, belongs tothe α-helixfamily of hematopoietic cytokines. It is produced by activated T-cells, mast cells and natural killer cells. IL-3 binds to the IL-3 receptor alpha subunit and recruits the signal-transducing common beta chain. IL-3induced signal transduction results in the survival, differentiation and proliferation of a variety of immune cells, such as macrophages, neutrophils, megakaryocytes, mast cells and hematopoietic stem cells. IL-3 often acts synergistically with other cytokines, such as IL-7, EPO, GM-CSF and IL-6, to exert its simulative function.

Product Specifications

Product Name Alternative

Interleukin-3, IL3

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 8 ng/ml, measured in a cell proliferation assay using NF S-60 cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

22-34 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant ratInterleukin-3 (IL-3), His remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rat Interleukin-3 (IL-3), His should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

ISDRGSDAHHLLRTLDCRTIALEILVKLPYPQVSGLNNSDDKANLRNSTLRRVNLDEFLKSQEEFDSQDTTDIKSKLQKL KCCIPAAASDSVLPGVYNKDLDDFKKKLRFYVIHLKDLQPVSVSRPPQPTSSSDNFRPMTVECHHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPRIN2 Peptide - N-terminal region
MBS3242252-01 0.1 mg

GPRIN2 Peptide - N-terminal region

Sign In for Pricing
View Details
GPRIN2 Peptide - N-terminal region
MBS3242252-02 5x 0.1 mg

GPRIN2 Peptide - N-terminal region

Sign In for Pricing
View Details
Cyclo (Val-Hpro)
orb507739 10 mg

Cyclo (Val-Hpro)

Sign In for Pricing
View Details
Rabbit Anti Human FKBP3 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot,Immunofluorescence)
IRBAHUFKBP3AP395120UL 1 Each

Rabbit Anti Human FKBP3 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot,Immunofluorescence)

Sign In for Pricing
View Details
Mouse Monoclonal NPRA/NPR1 Antibody (OTI7H7) [DyLight 755]
NBP2-73044IR 0.1 mL

Mouse Monoclonal NPRA/NPR1 Antibody (OTI7H7) [DyLight 755]

Sign In for Pricing
View Details
PNMA2 Antibody - C-terminal region
MBS3222123-01 0.1 mL

PNMA2 Antibody - C-terminal region

Sign In for Pricing
View Details