Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-3, His, Rat

Interleukin-3 (IL-3), also known as MCGF, Multi-CSF, HCGF and P-cell stimulation factor, belongs tothe α-helixfamily of hematopoietic cytokines. It is produced by activated T-cells, mast cells and natural killer cells. IL-3 binds to the IL-3 receptor alpha subunit and recruits the signal-transducing common beta chain. IL-3induced signal transduction results in the survival, differentiation and proliferation of a variety of immune cells, such as macrophages, neutrophils, megakaryocytes, mast cells and hematopoietic stem cells. IL-3 often acts synergistically with other cytokines, such as IL-7, EPO, GM-CSF and IL-6, to exert its simulative function.

Product Specifications

Product Name Alternative

Interleukin-3, IL3

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 8 ng/ml, measured in a cell proliferation assay using NF S-60 cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

22-34 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant ratInterleukin-3 (IL-3), His remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rat Interleukin-3 (IL-3), His should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

ISDRGSDAHHLLRTLDCRTIALEILVKLPYPQVSGLNNSDDKANLRNSTLRRVNLDEFLKSQEEFDSQDTTDIKSKLQKL KCCIPAAASDSVLPGVYNKDLDDFKKKLRFYVIHLKDLQPVSVSRPPQPTSSSDNFRPMTVECHHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAIP2 Antibody
C49459-01 40 µL

PAIP2 Antibody

Sign In for Pricing
View Details
PAIP2 Antibody
C49459-02 100 µL

PAIP2 Antibody

Sign In for Pricing
View Details
PAIP2 Antibody
C49459-03 200 µL

PAIP2 Antibody

Sign In for Pricing
View Details
FOXO1 Polyclonal Antibody, RBITC Conjugated
bs-23175R-RBITC 100 µL

FOXO1 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Lentiviral human GTF2F1 shRNA (UAS) - Lentiviral human GTF2F1 shRNA (UAS, iRFP) (25)
GTR15337673 1 Vial

Lentiviral human GTF2F1 shRNA (UAS) - Lentiviral human GTF2F1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
SMAD5 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-13890R-BF488-01 20 µL

SMAD5 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details