Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-3, His, Rat

Interleukin-3 (IL-3), also known as MCGF, Multi-CSF, HCGF and P-cell stimulation factor, belongs tothe α-helixfamily of hematopoietic cytokines. It is produced by activated T-cells, mast cells and natural killer cells. IL-3 binds to the IL-3 receptor alpha subunit and recruits the signal-transducing common beta chain. IL-3induced signal transduction results in the survival, differentiation and proliferation of a variety of immune cells, such as macrophages, neutrophils, megakaryocytes, mast cells and hematopoietic stem cells. IL-3 often acts synergistically with other cytokines, such as IL-7, EPO, GM-CSF and IL-6, to exert its simulative function.

Product Specifications

Product Name Alternative

Interleukin-3, IL3

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 8 ng/ml, measured in a cell proliferation assay using NF S-60 cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

22-34 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant ratInterleukin-3 (IL-3), His remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rat Interleukin-3 (IL-3), His should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

ISDRGSDAHHLLRTLDCRTIALEILVKLPYPQVSGLNNSDDKANLRNSTLRRVNLDEFLKSQEEFDSQDTTDIKSKLQKL KCCIPAAASDSVLPGVYNKDLDDFKKKLRFYVIHLKDLQPVSVSRPPQPTSSSDNFRPMTVECHHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5HT3B receptor Polyclonal Antibody
bs-4289R-TR 20 µL

5HT3B receptor Polyclonal Antibody

Sign In for Pricing
View Details
IL-33 Rabbit Monoclonal Antibody (Detector)
E56PA0443 100 µL

IL-33 Rabbit Monoclonal Antibody (Detector)

Sign In for Pricing
View Details
CDKN2D (Cyclin-Dependent Kinase Inhibitor 2D (p19, inhibits CDK4), INK4D, p19, p19-INK4D) (HRP)
244551-HRP 100 µL

CDKN2D (Cyclin-Dependent Kinase Inhibitor 2D (p19, inhibits CDK4), INK4D, p19, p19-INK4D) (HRP)

Sign In for Pricing
View Details
1- (4-Methylpyridin-2-yl) -1H-pyrazole-4-sulfonyl chloride
XZB07612-01 50 mg

1- (4-Methylpyridin-2-yl) -1H-pyrazole-4-sulfonyl chloride

Sign In for Pricing
View Details
1- (4-Methylpyridin-2-yl) -1H-pyrazole-4-sulfonyl chloride
XZB07612-02 0.5 g

1- (4-Methylpyridin-2-yl) -1H-pyrazole-4-sulfonyl chloride

Sign In for Pricing
View Details
Mouse Monoclonal MYBPC1 Antibody (83B24) [Janelia Fluor 635]
NBP2-50295JF635 0.1 mL

Mouse Monoclonal MYBPC1 Antibody (83B24) [Janelia Fluor 635]

Sign In for Pricing
View Details