Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-3, His, Rat

Interleukin-3 (IL-3), also known as MCGF, Multi-CSF, HCGF and P-cell stimulation factor, belongs tothe α-helixfamily of hematopoietic cytokines. It is produced by activated T-cells, mast cells and natural killer cells. IL-3 binds to the IL-3 receptor alpha subunit and recruits the signal-transducing common beta chain. IL-3induced signal transduction results in the survival, differentiation and proliferation of a variety of immune cells, such as macrophages, neutrophils, megakaryocytes, mast cells and hematopoietic stem cells. IL-3 often acts synergistically with other cytokines, such as IL-7, EPO, GM-CSF and IL-6, to exert its simulative function.

Product Specifications

Product Name Alternative

Interleukin-3, IL3

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 8 ng/ml, measured in a cell proliferation assay using NF S-60 cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

22-34 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant ratInterleukin-3 (IL-3), His remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rat Interleukin-3 (IL-3), His should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

ISDRGSDAHHLLRTLDCRTIALEILVKLPYPQVSGLNNSDDKANLRNSTLRRVNLDEFLKSQEEFDSQDTTDIKSKLQKL KCCIPAAASDSVLPGVYNKDLDDFKKKLRFYVIHLKDLQPVSVSRPPQPTSSSDNFRPMTVECHHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDX58 Antibody
orb191989-01 50 μL

DDX58 Antibody

Sign In for Pricing
View Details
DDX58 Antibody
orb191989-02 100 µL

DDX58 Antibody

Sign In for Pricing
View Details
Rabbit anti-TAKl Antibody, Affinity Purified
A301-915A 100 µg

Rabbit anti-TAKl Antibody, Affinity Purified

Sign In for Pricing
View Details
RISC discontinued
513659 100 µg

RISC discontinued

Sign In for Pricing
View Details
Human RNF11 Pre-designed siRNA Set B
SI013832B 1 Each

Human RNF11 Pre-designed siRNA Set B

Sign In for Pricing
View Details
C21orf29 Antibody (Center) Blocking Peptide
MBS9228116-01 0.5 mg

C21orf29 Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details