Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-4, His, Rat

Interleukin-4 (IL-4), also known as BSF-1 and Lymphocyte stimulatory factor 1, is a secreted cytokine belonging to the IL-4/IL-13 family. It is produced by mast cells, T cells and bone marrow stromal cells. IL-4 signals through two receptor complexes: theIL4Rα/common γ chain and the IL4Rα-IL-13 Rα1 receptor complex. IL-4 regulates T cell and B cell proliferation, survival and gene expression. IL-4 also induces IgG and IgE class switching, and the upregulation of MHC-II production.

Product Specifications

Product Name Alternative

Interleukin-4, IL4

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 0.2 μg/ml, measured in a proliferationassay using C6 cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

18-22 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant rat Interleukin-4 (IL-4), Hisremains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rat Interleukin-4 (IL-4), Hisshould be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

HGCNDSPLREIINTLNQVTEKGTPCTEMFVPDVLTATRNTTENELICRASRVLRKFYFPRDVPPCLKNKSGVLGELRKLC RGVSGLNSLRSCTVNESTLTTLKDFLESLKSILRGKYLQSCTSMSHHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IL-12 Antibody Pair Set
E-KAB-0081 50 µL & 100 µg

Mouse IL-12 Antibody Pair Set

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1527), Biotin conjugate, 0.1mg/mL
BNCB1950-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1527), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (SOX9/2287R), CF488A conjugate, 0.1mg/mL
BNC882287-500 1x 500 µL

SOX9 / SRY-box 9 (SOX9/2287R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LDL Receptor Recombinant Rabbit monoclonal Antibody
HA750107 100 µL

LDL Receptor Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CD8A Mouse Monoclonal Antibody [Clone ID: CC63]
AM05901PU-S 100 µg

CD8A Mouse Monoclonal Antibody [Clone ID: CC63]

Sign In for Pricing
View Details
Mouse Gcnt1 activation kit by CRISPRa
GA201571 1 Kit

Mouse Gcnt1 activation kit by CRISPRa

Sign In for Pricing
View Details