Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-4, His, Rat

Interleukin-4 (IL-4), also known as BSF-1 and Lymphocyte stimulatory factor 1, is a secreted cytokine belonging to the IL-4/IL-13 family. It is produced by mast cells, T cells and bone marrow stromal cells. IL-4 signals through two receptor complexes: theIL4Rα/common γ chain and the IL4Rα-IL-13 Rα1 receptor complex. IL-4 regulates T cell and B cell proliferation, survival and gene expression. IL-4 also induces IgG and IgE class switching, and the upregulation of MHC-II production.

Product Specifications

Product Name Alternative

Interleukin-4, IL4

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 0.2 μg/ml, measured in a proliferationassay using C6 cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

18-22 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant rat Interleukin-4 (IL-4), Hisremains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rat Interleukin-4 (IL-4), Hisshould be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

HGCNDSPLREIINTLNQVTEKGTPCTEMFVPDVLTATRNTTENELICRASRVLRKFYFPRDVPPCLKNKSGVLGELRKLC RGVSGLNSLRSCTVNESTLTTLKDFLESLKSILRGKYLQSCTSMSHHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Casein Kinase II Alpha (T251) CSNK2A1 Antibody
A02398T251 100 µL

Anti-Casein Kinase II Alpha (T251) CSNK2A1 Antibody

Sign In for Pricing
View Details
Murine IFN-g ELISpot Set
orb2705487 15 x 96 T (non-sterile plate)

Murine IFN-g ELISpot Set

Sign In for Pricing
View Details
Adrenodoxin, mitochondrial Antibody (Fluoro647)
orb3168194 100 µg

Adrenodoxin, mitochondrial Antibody (Fluoro647)

Sign In for Pricing
View Details
RGD1303003 3'UTR GFP Stable Cell Line
TU267525 1.0 mL

RGD1303003 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Anti-MafA Rabbit pAb
GB115015-50 50 μL

Anti-MafA Rabbit pAb

Sign In for Pricing
View Details
UBTD1, CT (G195) (Ubiquitin Domain-containing Protein 1) (APC)
MBS6504728-01 0.2 mL

UBTD1, CT (G195) (Ubiquitin Domain-containing Protein 1) (APC)

Sign In for Pricing
View Details