RecombinantIL-4, His, Rat
Interleukin-4 (IL-4), also known as BSF-1 and Lymphocyte stimulatory factor 1, is a secreted cytokine belonging to the IL-4/IL-13 family. It is produced by mast cells, T cells and bone marrow stromal cells. IL-4 signals through two receptor complexes: theIL4Rα/common γ chain and the IL4Rα-IL-13 Rα1 receptor complex. IL-4 regulates T cell and B cell proliferation, survival and gene expression. IL-4 also induces IgG and IgE class switching, and the upregulation of MHC-II production.
Product Specifications
Product Name Alternative
Interleukin-4, IL4
Source
CHO
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 95% as analyzed by SDS-PAGE.
Bioactivity
ED50 < 0.2 μg/ml, measured in a proliferationassay using C6 cells.
Form
Lyophilized after extensive dialysis against PBS.
Molecular Weight
18-22 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Notes
For research use only.
Applications Notes
Reconstituted in ddH2O or PBS at 100 μg/ml.
Preservative
Lyophilized after extensive dialysis against PBS.
AA Sequence
HGCNDSPLREIINTLNQVTEKGTPCTEMFVPDVLTATRNTTENELICRASRVLRKFYFPRDVPPCLKNKSGVLGELRKLC RGVSGLNSLRSCTVNESTLTTLKDFLESLKSILRGKYLQSCTSMSHHHHHH
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
CAPN1 CRISPRa sgRNA lentivector (set of three targets)(Rat)
PTEN (Phosphatase and Tensin Homologue Deleted on Chromosome Ten, BZS, DEC, GLM2, MHAM, TEP1, MMAC1, PTEN1, 10q23del) (MaxLight 650)
PTEN (Phosphatase and Tensin Homologue Deleted on Chromosome Ten, BZS, DEC, GLM2, MHAM, TEP1, MMAC1, PTEN1, 10q23del) (MaxLight 650)
C/EBP β Lentiviral Activation Particles (m2)
