Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-4, Mouse

Interleukin-4 (IL-4) is a pleiotropic cytokine regulates diverse T and B cell responses including cell proliferation, survival, and gene expression. It has important effects on the growth and differentiation of different immunologically competent cells. Interleukin-4 is produced by mast cells, T cells, and bone marrow stromal cells[1]. IL-4 regulates the differentiation of native CD4+ T cells (Th0 cells) into helper Th2 cells, and regulates the immunoglobulin class switching to the IgG1 and IgE isotypes. IL-4 has numerous important biological functions including stimulating B-cells activation, T-cell proliferation and CD4+ T-cells differentiation to Th2 cells. It is a key regulator in hormone control and adaptive immunity[2]. IL-4 also plays a major role in inflammation response and wound repair via activation of macrophage into M2 cells[3]. IL-4 is stabilized by three disulphide bonds forming a compact globular protein structure[4]. Four alpha-helix bundle with left-handed twist is dominated half of the protein structure with 2 overhand connections and fall into a 2-stranded anti-parallel beta sheet[5].

Product Specifications

Product Name Alternative

Interleukin-4, IL4

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 5 x 10ˆ5 units/mg.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

15 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Murine Interleukin 4 (IL-4) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rmIL-4 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQR LFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CST11 (NM_080830) Human Untagged Clone
SC305858 10 µg

CST11 (NM_080830) Human Untagged Clone

Sign In for Pricing
View Details
ZG16B sgRNA CRISPR Lentivector (Human) (Target 1)
K2676502 1.0 µg DNA

ZG16B sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Rif1 Lentiviral Activation Particles (m)
sc-424565-LAC 200 µL

Rif1 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Cow CRP Matched Antibody Pair Set [ABP-S-051513]
ABP-S-051513 5 Plates

Cow CRP Matched Antibody Pair Set [ABP-S-051513]

Sign In for Pricing
View Details
{1-Amino-2-[ (4-chlorophenyl) thio]ethylidene}malononitrile
OR1003383-01 250 mg

{1-Amino-2-[ (4-chlorophenyl) thio]ethylidene}malononitrile

Sign In for Pricing
View Details
{1-Amino-2-[ (4-chlorophenyl) thio]ethylidene}malononitrile
OR1003383-02 500 mg

{1-Amino-2-[ (4-chlorophenyl) thio]ethylidene}malononitrile

Sign In for Pricing
View Details