Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-4, Mouse

Interleukin-4 (IL-4) is a pleiotropic cytokine regulates diverse T and B cell responses including cell proliferation, survival, and gene expression. It has important effects on the growth and differentiation of different immunologically competent cells. Interleukin-4 is produced by mast cells, T cells, and bone marrow stromal cells[1]. IL-4 regulates the differentiation of native CD4+ T cells (Th0 cells) into helper Th2 cells, and regulates the immunoglobulin class switching to the IgG1 and IgE isotypes. IL-4 has numerous important biological functions including stimulating B-cells activation, T-cell proliferation and CD4+ T-cells differentiation to Th2 cells. It is a key regulator in hormone control and adaptive immunity[2]. IL-4 also plays a major role in inflammation response and wound repair via activation of macrophage into M2 cells[3]. IL-4 is stabilized by three disulphide bonds forming a compact globular protein structure[4]. Four alpha-helix bundle with left-handed twist is dominated half of the protein structure with 2 overhand connections and fall into a 2-stranded anti-parallel beta sheet[5].

Product Specifications

Product Name Alternative

Interleukin-4, IL4

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 5 x 10ˆ5 units/mg.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

15 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Murine Interleukin 4 (IL-4) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rmIL-4 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQR LFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIRC89 Protein Lysate (Human) with C-Ha Tag
36829031 100 µg

PIRC89 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Acetyl Coenzyme A Carboxylase Recombinant Rabbit mAb
E43S47811 100 µL

Acetyl Coenzyme A Carboxylase Recombinant Rabbit mAb

Sign In for Pricing
View Details
COMMD3 Rabbit pAb
E47R8183 100 µL

COMMD3 Rabbit pAb

Sign In for Pricing
View Details
MMP9 Rabbit Polyclonal Antibody (Carrier-free)
orb3076320 100 µg

MMP9 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
CDKN2A/p16-INK4a Polyclonal Antibody
bs-20656R 100 µL

CDKN2A/p16-INK4a Polyclonal Antibody

Sign In for Pricing
View Details
CLC-7 Polyclonal Antibody
E20-70961 100 µg

CLC-7 Polyclonal Antibody

Sign In for Pricing
View Details