Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-4, Porcine

Interleukin-4 (IL-4) is a pleiotropic cytokine regulates diverse T and B cell responses including cell proliferation, survival, and gene expression. It has important effects on the growth and differentiation of different immunologically competent cells. Interleukin-4 is produced by mast cells, T cells, and bone marrow stromal cells [1]. IL-4 regulates the differentiation of native CD4+ T cells (Th0 cells) into helper Th2 cells, and regulates the immunoglobulin class switching to the IgG1 and IgE isotypes. IL-4 has numerous important biological functions including stimulating B-cells activation, T-cell proliferation and CD4+ T-cells differentiation to Th2 cells. It is a key regulator in hormone control and adaptive immunity [2]. IL-4 also plays a major role in inflammation response and wound repair via activation of macrophage into M2 cells [3]. IL-4 is stabilized by three disulphide bonds forming a compact globular protein structure [4]. Four alpha-helix bundle with left-handed twist is dominated half of the protein structure with 2 overhand connections and fall into a 2-stranded anti-parallel beta sheet [5].

Product Specifications

Product Name Alternative

Interleukin-4, IL4

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED504 x 10ˆ6 units/mg

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

15kDa, observed by reducing SDS-PAGE

Storage Conditions

Lyophilized recombinant porcine Interleukin 4 (IL-4) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rpIL-4 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

HKCDITLQEIIKTLNILTARKNSCMELPVTDVFAAPENTTEKETFCRASTVLRHIYRHHTCMKSLLSGLDRNLSSMANMTCSVHEAKKSTLKDFLERLKTIMKEKYSKC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Chloro-3-nitrophenylacetonitrile
OR4825 1 Each

4-Chloro-3-nitrophenylacetonitrile

Sign In for Pricing
View Details
Human CD34, soluble
MBS692218-01 0.005 mg

Human CD34, soluble

Sign In for Pricing
View Details
Human CD34, soluble
MBS692218-02 0.02 mg

Human CD34, soluble

Sign In for Pricing
View Details
Human CD34, soluble
MBS692218-03 5x 0.02 mg

Human CD34, soluble

Sign In for Pricing
View Details
MRPL55 (NM_181456) Human Tagged Lenti ORF Clone
RC223293L4 10 µg

MRPL55 (NM_181456) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
AlbuVoid Buffer Kit - 500
AVBK-50 50 mL

AlbuVoid Buffer Kit - 500

Sign In for Pricing
View Details