Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-5Rα, Human

Interleukin-5 Receptor Alpha (IL-5RA), also known as CD125, belongs to the Type 5 subfamily in the type I cytokine receptor family. It is composed of a ligand-specific alpha subunit and a signal-transducing beta subunit shared by the receptors for IL-3 and GM-CSF. IL-5RA is mainly expressed on eosinophils and basophils, and plays important roles in the immunobiology of these cell types. It is reported that when stimulated by IL-5, eosinophils down-regulate surface IL-5RA expression to attenuate their IL-5 responsiveness. Elevated IL-5 production may induce immune cell infiltration which leads to allergic inflammation. IL-5RA has also been reported to promote the differentiation of basophils and B cells.

Product Specifications

Product Name Alternative

IL-5RA, CD125

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 0.2 ng/ml, measured in a cell proliferation assay using TF-1 cells in the presence of 1 ng/ml human IL-5.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

53-56 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Interleukin-5 Receptor Alpha remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interleukin-5 Receptor Alpha should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

DLLPDEKISLLPPVNFTIKVTGLAQVLLQWKPNPDQEQRNVNLEYQVKINAPKEDDYETRITESKCVTILHKGFSASVRT ILQNDHSLLASSWASAELHAPPGSPGTSIVNLTCTTNTTEDNYSRLRSYQVSLHCTWLVGTDAPEDTQYFLYYRYGSWTE ECQEYSKDTLGRNIACWFPRTFILSKGRDWLAVLVNGSSKHSAIRPFDQLFALHAIDQINPPLNVTAEIEGTRLSIQWEK PVSAFPIHCFDYEVKIHNTRNGYLQIEKLMTNAFISIIDDLSKYDVQVRAAVSSMCREAGLWSEWSQPIYVGNDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit NT-4 (Neurotrophin 4) ELISA Kit
MBS2511915-01 24 Tests

Rabbit NT-4 (Neurotrophin 4) ELISA Kit

Sign In for Pricing
View Details
Rabbit NT-4 (Neurotrophin 4) ELISA Kit
MBS2511915-02 48 Tests

Rabbit NT-4 (Neurotrophin 4) ELISA Kit

Sign In for Pricing
View Details
Rabbit NT-4 (Neurotrophin 4) ELISA Kit
MBS2511915-03 96 Tests

Rabbit NT-4 (Neurotrophin 4) ELISA Kit

Sign In for Pricing
View Details
Rabbit NT-4 (Neurotrophin 4) ELISA Kit
MBS2511915-04 5x 96 Tests

Rabbit NT-4 (Neurotrophin 4) ELISA Kit

Sign In for Pricing
View Details
Rabbit NT-4 (Neurotrophin 4) ELISA Kit
MBS2511915-05 10x 96 Tests

Rabbit NT-4 (Neurotrophin 4) ELISA Kit

Sign In for Pricing
View Details
Recombinant Bacillus licheniformis Protein sinI (sinI)
MBS1226179-01 0.02 mg (E-Coli)

Recombinant Bacillus licheniformis Protein sinI (sinI)

Sign In for Pricing
View Details