Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-5, Human (CHO-expressed)

Interleukin-5 (IL-5), produced by mast cells, T cells and eosinophils, is responsible for the activities attributed to eosinophil differentiating factor, B cell growth factor II and T cell-replacing factor (TRF) . It can increase production and mobilization of eosinophils and CD34+ progenitors from the bone marrow. IL-5 plays an important role in inducing cell-mediated immunity against parasitic infections and certain tumors. IL-5 also promotes differentiation of basophils and primes them for histamine and leukotriene release.Recombinant Human IL-5 is homodimeric protein with molecular weight ranging from 29 to 35 kDa due to glycosylation.

Product Specifications

Product Name Alternative

Interleukin-5, IL5

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 1x10ˆ6 units/mg.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

~29-35 kDa, observed by non-reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human Interlerkin 5 (rhIL-5) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhIL-5 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

IPTEIPTSALVKETLALLSTHRTLLIANETLRIPVPVHKNHQLCTEEIFQGIGTLESQTVQGGTVERLFKNLSLIKKYID GQKKKCGEERRRVNQFLDYLQEFLGVMNTEWIIES

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCN Peptide
orb2015002 100 µg

DCN Peptide

Sign In for Pricing
View Details
SCN7A sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
43186111 3x 1.0 µg

SCN7A sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
ISCA2, ID (ISCA2, HBLD1, Iron-sulfur cluster assembly 2 homolog, mitochondrial, HESB-like domain-containing protein 1) (FITC) discontinued
037117-FITC 200 µL

ISCA2, ID (ISCA2, HBLD1, Iron-sulfur cluster assembly 2 homolog, mitochondrial, HESB-like domain-containing protein 1) (FITC) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal CD36/SR-B3 Antibody [Janelia Fluor 646]
NB400-145JF646 0.1 mL

Rabbit Polyclonal CD36/SR-B3 Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
DENND3 Protein Vector (Human) (pPB-N-His)
PV072798 500 ng

DENND3 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
PDE5A CRISPR Knock Out 293T Cell Line (Human)
36288141 1x 10^6 Cells / 1.0 mL

PDE5A CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details