Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-5, Human (CHO-expressed)

Interleukin-5 (IL-5), produced by mast cells, T cells and eosinophils, is responsible for the activities attributed to eosinophil differentiating factor, B cell growth factor II and T cell-replacing factor (TRF) . It can increase production and mobilization of eosinophils and CD34+ progenitors from the bone marrow. IL-5 plays an important role in inducing cell-mediated immunity against parasitic infections and certain tumors. IL-5 also promotes differentiation of basophils and primes them for histamine and leukotriene release.Recombinant Human IL-5 is homodimeric protein with molecular weight ranging from 29 to 35 kDa due to glycosylation.

Product Specifications

Product Name Alternative

Interleukin-5, IL5

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 1x10ˆ6 units/mg.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

~29-35 kDa, observed by non-reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human Interlerkin 5 (rhIL-5) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhIL-5 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

IPTEIPTSALVKETLALLSTHRTLLIANETLRIPVPVHKNHQLCTEEIFQGIGTLESQTVQGGTVERLFKNLSLIKKYID GQKKKCGEERRRVNQFLDYLQEFLGVMNTEWIIES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mapk1ip1l sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4749205 3x 1.0 µg

Mapk1ip1l sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
RN5S58 Recombinant Protein (Human)
RP088371 100 µg

RN5S58 Recombinant Protein (Human)

Sign In for Pricing
View Details
Dog UMOD / Uromodulin Recombinant Protein
R2280d 1 Each

Dog UMOD / Uromodulin Recombinant Protein

Sign In for Pricing
View Details
MAChR M1 Polyclonal Antibody
E20-72611 100 µg

MAChR M1 Polyclonal Antibody

Sign In for Pricing
View Details
Human Dendrin (DDN) activation kit by CRISPRa
GA108044 1 Kit

Human Dendrin (DDN) activation kit by CRISPRa

Sign In for Pricing
View Details
DLC-1 Lentiviral Activation Particles (m)
sc-424482-LAC 200 µL

DLC-1 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details