Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-5, Human (CHO-expressed)

Interleukin-5 (IL-5), produced by mast cells, T cells and eosinophils, is responsible for the activities attributed to eosinophil differentiating factor, B cell growth factor II and T cell-replacing factor (TRF) . It can increase production and mobilization of eosinophils and CD34+ progenitors from the bone marrow. IL-5 plays an important role in inducing cell-mediated immunity against parasitic infections and certain tumors. IL-5 also promotes differentiation of basophils and primes them for histamine and leukotriene release.Recombinant Human IL-5 is homodimeric protein with molecular weight ranging from 29 to 35 kDa due to glycosylation.

Product Specifications

Product Name Alternative

Interleukin-5, IL5

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 1x10ˆ6 units/mg.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

~29-35 kDa, observed by non-reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human Interlerkin 5 (rhIL-5) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhIL-5 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

IPTEIPTSALVKETLALLSTHRTLLIANETLRIPVPVHKNHQLCTEEIFQGIGTLESQTVQGGTVERLFKNLSLIKKYID GQKKKCGEERRRVNQFLDYLQEFLGVMNTEWIIES

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IL-1 RL1 / ST2 ELISA Kit PicoKine®
EK1116 96 Well With Removable Strips

Human IL-1 RL1 / ST2 ELISA Kit PicoKine®

Sign In for Pricing
View Details
ALS2CR7 CRISPR Activation Plasmid (h2)
sc-417103-ACT-2 20 µg

ALS2CR7 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Zegocractin (CM 4620)
S6834-25mg 25 mg

Zegocractin (CM 4620)

Sign In for Pricing
View Details
PTPRR Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV685998 1.0 µg DNA

PTPRR Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
ABCA12 3'UTR Lenti-reporter-Luc Vector
11011081 1.0 µg

ABCA12 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
HnRNP K (HNRNPK) (NM_031262) Human Over-expression Lysate
E45H12470-2 20 µg

HnRNP K (HNRNPK) (NM_031262) Human Over-expression Lysate

Sign In for Pricing
View Details