Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-5, Mouse (CHO-expressed)

Interleukin-5 (IL-5), produced by mast cells, T cells and eosinophils, is responsible for the activities attributed to eosinophil differentiating factor, B cell growth factor II and T cell-replacing factor (TRF) . It can increase production and mobilization of eosinophils and CD34+ progenitors from the bone marrow. IL-5 plays an important role in inducing cell-mediated immunity against parasitic infections and certain tumors. IL-5 also promotes differentiation of basophils and primes them for histamine and leukotriene release.Recombinant Murine IL-5 is homodimeric protein with molecular weight ranging from 25 to 40 kDa due to glycosylation.

Product Specifications

Product Name Alternative

Interleukin-5, IL5

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 2x10ˆ6 units/mg.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

25-40 kDa, observed by non-reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Murine Interlerkin 5 (IL-5) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rmIL-5 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQ KEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDX2 Antibody - middle region : FITC (ARP31476_P050-FITC)
ARP31476_P050-FITC 100 µL

CDX2 Antibody - middle region : FITC (ARP31476_P050-FITC)

Sign In for Pricing
View Details
MEK-1 (phospho Thr386) Polyclonal Antibody
MBS8520199-01 0.1 mg

MEK-1 (phospho Thr386) Polyclonal Antibody

Sign In for Pricing
View Details
MEK-1 (phospho Thr386) Polyclonal Antibody
MBS8520199-02 0.1 mL (AF635)

MEK-1 (phospho Thr386) Polyclonal Antibody

Sign In for Pricing
View Details
MEK-1 (phospho Thr386) Polyclonal Antibody
MBS8520199-03 0.1 mL (AF610)

MEK-1 (phospho Thr386) Polyclonal Antibody

Sign In for Pricing
View Details
MEK-1 (phospho Thr386) Polyclonal Antibody
MBS8520199-04 0.1 mL (AF405S)

MEK-1 (phospho Thr386) Polyclonal Antibody

Sign In for Pricing
View Details
MEK-1 (phospho Thr386) Polyclonal Antibody
MBS8520199-05 0.1 mL (AF405L)

MEK-1 (phospho Thr386) Polyclonal Antibody

Sign In for Pricing
View Details