Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-5, Mouse (CHO-expressed)

Interleukin-5 (IL-5), produced by mast cells, T cells and eosinophils, is responsible for the activities attributed to eosinophil differentiating factor, B cell growth factor II and T cell-replacing factor (TRF) . It can increase production and mobilization of eosinophils and CD34+ progenitors from the bone marrow. IL-5 plays an important role in inducing cell-mediated immunity against parasitic infections and certain tumors. IL-5 also promotes differentiation of basophils and primes them for histamine and leukotriene release.Recombinant Murine IL-5 is homodimeric protein with molecular weight ranging from 25 to 40 kDa due to glycosylation.

Product Specifications

Product Name Alternative

Interleukin-5, IL5

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 2x10ˆ6 units/mg.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

25-40 kDa, observed by non-reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Murine Interlerkin 5 (IL-5) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rmIL-5 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQ KEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LBP Rabbit Polyclonal Antibody (Fluoro550)
orb3116729 100 µg

LBP Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
MCAM Antibody
MBS8500502-01 0.1 mg

MCAM Antibody

Sign In for Pricing
View Details
MCAM Antibody
MBS8500502-02 0.1 mL (AF405L)

MCAM Antibody

Sign In for Pricing
View Details
MCAM Antibody
MBS8500502-03 0.1 mL (AF405S)

MCAM Antibody

Sign In for Pricing
View Details
MCAM Antibody
MBS8500502-04 0.1 mL (AF610)

MCAM Antibody

Sign In for Pricing
View Details
MCAM Antibody
MBS8500502-05 0.1 mL (AF635)

MCAM Antibody

Sign In for Pricing
View Details