Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-6, Human (CHO-expressed)

Interleukin-6 (IL-6), also known as BSF-2, CDF and IFNB2, is a pleiotropic cytokine that acts in both pro-inflammatory and anti-inflammatory responses. It is produced mainly by T cells, macrophages, monocytes, endothelial cells and muscle cells. IL-6 binds to IL-6 receptor (IL-6R) to trigger the association of IL-6R with gp130, inducing signal transduction through JAKs and STATs. The biological functions of IL-6 are diverse. It stimulates B cell differentiation and antibody production, myeloma and plasmacytoma growth, as well as nerve cell differentiation. It also acts as a myokine, produced by muscle cells in response to muscle contraction, to be released to the blood stream to help break down fats and improve insulin resistance.

Product Specifications

Product Name Alternative

Interleukin-6, IL6

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 0.06 ng/ml, measured in a cell proliferation assay using 7TD1 cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

21-23 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Interleukin-6 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interleukin-6 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

PVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNE ETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQD MTTHLILRSFKEFLQSSLRALRQM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPAG4L (SUN Domain-containing Protein 5, Sad1 and UNC84 Domain-containing Protein 5, Sperm-associated Antigen 4-like Protein, Testis and Spermatogenesis-related Gene 4 Protein, SUN5, TSARG4, MGC33594)
133741 50 µg

SPAG4L (SUN Domain-containing Protein 5, Sad1 and UNC84 Domain-containing Protein 5, Sperm-associated Antigen 4-like Protein, Testis and Spermatogenesis-related Gene 4 Protein, SUN5, TSARG4, MGC33594)

Sign In for Pricing
View Details
RHD Protein (N-GST, Human)
P507802 100 µg

RHD Protein (N-GST, Human)

Sign In for Pricing
View Details
Human VTCN1 (V-set domain-containing T-cell activation inhibitor 1) QuickTest ELISA Kit
MBS7618796-01 48 Well

Human VTCN1 (V-set domain-containing T-cell activation inhibitor 1) QuickTest ELISA Kit

Sign In for Pricing
View Details
Human VTCN1 (V-set domain-containing T-cell activation inhibitor 1) QuickTest ELISA Kit
MBS7618796-02 96 Well

Human VTCN1 (V-set domain-containing T-cell activation inhibitor 1) QuickTest ELISA Kit

Sign In for Pricing
View Details
Human VTCN1 (V-set domain-containing T-cell activation inhibitor 1) QuickTest ELISA Kit
MBS7618796-03 5x 96 Well

Human VTCN1 (V-set domain-containing T-cell activation inhibitor 1) QuickTest ELISA Kit

Sign In for Pricing
View Details
Human VTCN1 (V-set domain-containing T-cell activation inhibitor 1) QuickTest ELISA Kit
MBS7618796-04 10x 96 Well

Human VTCN1 (V-set domain-containing T-cell activation inhibitor 1) QuickTest ELISA Kit

Sign In for Pricing
View Details