Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-6, Human (CHO-expressed)

Interleukin-6 (IL-6), also known as BSF-2, CDF and IFNB2, is a pleiotropic cytokine that acts in both pro-inflammatory and anti-inflammatory responses. It is produced mainly by T cells, macrophages, monocytes, endothelial cells and muscle cells. IL-6 binds to IL-6 receptor (IL-6R) to trigger the association of IL-6R with gp130, inducing signal transduction through JAKs and STATs. The biological functions of IL-6 are diverse. It stimulates B cell differentiation and antibody production, myeloma and plasmacytoma growth, as well as nerve cell differentiation. It also acts as a myokine, produced by muscle cells in response to muscle contraction, to be released to the blood stream to help break down fats and improve insulin resistance.

Product Specifications

Product Name Alternative

Interleukin-6, IL6

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 0.06 ng/ml, measured in a cell proliferation assay using 7TD1 cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

21-23 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Interleukin-6 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interleukin-6 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

PVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNE ETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQD MTTHLILRSFKEFLQSSLRALRQM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Interferon Beta (IFNb, IFNB1, IFN-B, IFB, IFF, IFNB, Interferon Beta 1 Fibroblast)
140909 200 µL

Interferon Beta (IFNb, IFNB1, IFN-B, IFB, IFF, IFNB, Interferon Beta 1 Fibroblast)

Sign In for Pricing
View Details
NDUFB4 Rabbit Polyclonal Antibody (Fluoro647)
orb3095650 100 µg

NDUFB4 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
LRRC28 Antibody
orb1269542 400 μl

LRRC28 Antibody

Sign In for Pricing
View Details
CD300ld Knockout HCT116 Polyclonal Cells
ARG43487 1 Million

CD300ld Knockout HCT116 Polyclonal Cells

Sign In for Pricing
View Details
PLAG1 (Zinc Finger Protein PLAG1, Pleiomorphic Adenoma Gene 1 Protein) (MaxLight 650)
MBS6220436-01 0.1 mL

PLAG1 (Zinc Finger Protein PLAG1, Pleiomorphic Adenoma Gene 1 Protein) (MaxLight 650)

Sign In for Pricing
View Details
PLAG1 (Zinc Finger Protein PLAG1, Pleiomorphic Adenoma Gene 1 Protein) (MaxLight 650)
MBS6220436-02 5x 0.1 mL

PLAG1 (Zinc Finger Protein PLAG1, Pleiomorphic Adenoma Gene 1 Protein) (MaxLight 650)

Sign In for Pricing
View Details