Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-6R, Human

Interleukin-6 Receptor Alpha, also known as IL-6RA, IL-6R1 and CD126, belongs to the type I cytokine receptor family. It is mainly expressed on T cells, fibroblasts and macrophages. IL-6RA couples with gp130 to form the IL-6 receptor; IL-6RA binds specifically to IL-6 and depends on gp130 to transmit signals. IL-6RA dysfunction has been correlated with the pathogenesis of many diseases, such as multiple myeloma, autoimmune diseases and prostate cancer. Soluble IL-6RA, which consists of only the extracellular domain of IL-6RA, acts as an agonist of IL-6 activity.

Product Specifications

Product Name Alternative

IL-6RA, IL-6R1, CD126

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 0.2 μg/ml, measured in a cell proliferation assay using M1 cells in the presence of 10 ng/ml human IL-6.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

54-56 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Interleukin-6 Receptor Alpha remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interleukin-6 Receptor Alpha should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRA GRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLA VPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRA ERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKD DDNILFRDSANATSLPVQDSSSVPLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL6R (NM_000565) Human Recombinant Protein
PH34346M5 20 µg

IL6R (NM_000565) Human Recombinant Protein

Sign In for Pricing
View Details
Human Gasdermin D (GSDMD) ELISA Kit
MBS2705515-01 24 Strip Well

Human Gasdermin D (GSDMD) ELISA Kit

Sign In for Pricing
View Details
Human Gasdermin D (GSDMD) ELISA Kit
MBS2705515-02 48 Well

Human Gasdermin D (GSDMD) ELISA Kit

Sign In for Pricing
View Details
Human Gasdermin D (GSDMD) ELISA Kit
MBS2705515-03 96 Well

Human Gasdermin D (GSDMD) ELISA Kit

Sign In for Pricing
View Details
Human Gasdermin D (GSDMD) ELISA Kit
MBS2705515-04 5x 96 Well

Human Gasdermin D (GSDMD) ELISA Kit

Sign In for Pricing
View Details
Human Gasdermin D (GSDMD) ELISA Kit
MBS2705515-05 10x 96 Well

Human Gasdermin D (GSDMD) ELISA Kit

Sign In for Pricing
View Details