Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-6R, Human

Interleukin-6 Receptor Alpha, also known as IL-6RA, IL-6R1 and CD126, belongs to the type I cytokine receptor family. It is mainly expressed on T cells, fibroblasts and macrophages. IL-6RA couples with gp130 to form the IL-6 receptor; IL-6RA binds specifically to IL-6 and depends on gp130 to transmit signals. IL-6RA dysfunction has been correlated with the pathogenesis of many diseases, such as multiple myeloma, autoimmune diseases and prostate cancer. Soluble IL-6RA, which consists of only the extracellular domain of IL-6RA, acts as an agonist of IL-6 activity.

Product Specifications

Product Name Alternative

IL-6RA, IL-6R1, CD126

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE and HPLC.

Bioactivity

ED50 < 0.2 μg/ml, measured in a cell proliferation assay using M1 cells in the presence of 10 ng/ml human IL-6.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

54-56 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Interleukin-6 Receptor Alpha remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interleukin-6 Receptor Alpha should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRA GRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLA VPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRA ERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKD DDNILFRDSANATSLPVQDSSSVPLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ICOS rabbit pAb
ES8392-01 50 µL

ICOS rabbit pAb

Sign In for Pricing
View Details
ICOS rabbit pAb
ES8392-02 100 µL

ICOS rabbit pAb

Sign In for Pricing
View Details
FITC anti-rat CD49d
E16FRF049d-050U 50 µg

FITC anti-rat CD49d

Sign In for Pricing
View Details
Canine cicatricial Pemphigoid, CP ELISA Kit
GTR10325051 96 Well

Canine cicatricial Pemphigoid, CP ELISA Kit

Sign In for Pricing
View Details
ROMO1 Antibody, HRP conjugated
MBS1499545-01 0.05 mg

ROMO1 Antibody, HRP conjugated

Sign In for Pricing
View Details
ROMO1 Antibody, HRP conjugated
MBS1499545-02 0.1 mg

ROMO1 Antibody, HRP conjugated

Sign In for Pricing
View Details