Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-7, His, Human (CHO-expressed)

Interleukin-7 (IL-7), also known as lymphopoietin 1 and pre-B cell factor, is a hematopoietic growth factor belonging to the IL-7/IL-9 family. It is produced by keratinocytes, dendritic cells, hepatocytes, neurons and epithelial cells. IL-7 binds and signals through IL-7 receptor, a heterodimer consisting of IL-7 receptor alpha and common gamma chain receptor. IL-7 plays a role in regulating early B cell and T cell development. It is also important for optimal dendritic cell-T cell interaction.

Product Specifications

Product Name Alternative

Interleukin-7, IL7

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 0.2ng /ml, measured in a cell proliferation assay using 2E8 cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

24-34 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human Interleukin-7 (IL-7), His remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human Interleukin-7 (IL-7), His should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLL KVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEHHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM253 (NM_001146683) Human Over-expression Lysate
LY431176 100 µg

TMEM253 (NM_001146683) Human Over-expression Lysate

Sign In for Pricing
View Details
Tenascin (T2H5), CF568 conjugate, 0.1mg/mL
BNC680392-100 1x 100 µL

Tenascin (T2H5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
17b-Hydroxyprogesterone
TRC-H950195-1G 1 g

17b-Hydroxyprogesterone

Sign In for Pricing
View Details
CD14 (Monocyte / Macrophage Marker) (LPSR/2386), CF488A conjugate, 0.1mg/mL
BNC882386-500 1x 500 µL

CD14 (Monocyte / Macrophage Marker) (LPSR/2386), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Colec12 Mouse Gene Knockout Kit (CRISPR)
KN503659 1 Kit

Colec12 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CLEC2D (NM_001004419) Human Over-expression Lysate
LY423748 100 µg

CLEC2D (NM_001004419) Human Over-expression Lysate

Sign In for Pricing
View Details