Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-7, His, Human (CHO-expressed)

Interleukin-7 (IL-7), also known as lymphopoietin 1 and pre-B cell factor, is a hematopoietic growth factor belonging to the IL-7/IL-9 family. It is produced by keratinocytes, dendritic cells, hepatocytes, neurons and epithelial cells. IL-7 binds and signals through IL-7 receptor, a heterodimer consisting of IL-7 receptor alpha and common gamma chain receptor. IL-7 plays a role in regulating early B cell and T cell development. It is also important for optimal dendritic cell-T cell interaction.

Product Specifications

Product Name Alternative

Interleukin-7, IL7

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 0.2ng /ml, measured in a cell proliferation assay using 2E8 cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

24-34 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human Interleukin-7 (IL-7), His remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human Interleukin-7 (IL-7), His should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLL KVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEHHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC16A6 Protein Lysate
OCOA12999-20UG 20 µg

SLC16A6 Protein Lysate

Sign In for Pricing
View Details
MFluor™ Green 620 Anti-non-human primates/ human CD170 Antibody *1A5*
117000U1-AAT 500 Tests

MFluor™ Green 620 Anti-non-human primates/ human CD170 Antibody *1A5*

Sign In for Pricing
View Details
Rabbit Anti-Rat Galectin 1 (GAL1) Polyclonal Antibody
VD1N444 1 Each

Rabbit Anti-Rat Galectin 1 (GAL1) Polyclonal Antibody

Sign In for Pricing
View Details
ROX Reference Dye (High)
ROXH-50μL 50 μL

ROX Reference Dye (High)

Sign In for Pricing
View Details
ANO2 CRISPR Activation Plasmid (m)
sc-433990-ACT 20 µg

ANO2 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
CTNNBL1 (NM_030877) Human Over-expression Lysate
LY403090 100 µg

CTNNBL1 (NM_030877) Human Over-expression Lysate

Sign In for Pricing
View Details