Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIL-7, His, Rat

Interleukin-7 (IL-7), also known as lymphopoietin 1 and pre-B cell factor, is a hematopoietic growth factor belonging to the IL-7/IL-9 family. It is produced by keratinocytes, dendritic cells, hepatocytes, neurons and epithelial cells. IL-7 binds and signals through IL-7 receptor, a heterodimer consisting of IL-7 receptor alpha and common gamma chain receptor. IL-7 plays a role in regulating early B cell and T cell development. It is also important for optimal dendritic cell-T cell interaction.

Product Specifications

Product Name Alternative

Interleukin-7, IL7

Source

CHO

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 22 ng /ml, measured in a cell proliferation assay using 2E8 cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

20-28 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant rat Interleukin-7 (IL-7), His remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rat Interleukin-7 (IL-7), His should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

DCHIKDKDGKAFGSVLMISINQLDKMTGTDSDCPNNEPNFFKKHLCDDTKEAAFLNRAARKLRQFLKMNISEEFNDHLLR VSDGTQTLVNCTSKEEKTIKEQKKNDPCFLKRLLREIKTCWNKILKGSIHHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CellBrite® Steady 568 Membrane Staining Kit, 100 Labelings
#30150-T 1 Unit

CellBrite® Steady 568 Membrane Staining Kit, 100 Labelings

Sign In for Pricing
View Details
TTC38 Polyclonal Antibody
E-AB-19056-01 20 µL

TTC38 Polyclonal Antibody

Sign In for Pricing
View Details
TTC38 Polyclonal Antibody
E-AB-19056-02 60 µL

TTC38 Polyclonal Antibody

Sign In for Pricing
View Details
TTC38 Polyclonal Antibody
E-AB-19056-03 120 µL

TTC38 Polyclonal Antibody

Sign In for Pricing
View Details
TTC38 Polyclonal Antibody
E-AB-19056-04 200 µL

TTC38 Polyclonal Antibody

Sign In for Pricing
View Details
3-Mercaptopicolinic Acid Hydrochloride
TRC-M257000-500MG 500 mg

3-Mercaptopicolinic Acid Hydrochloride

Sign In for Pricing
View Details